BLASTX nr result
ID: Cinnamomum23_contig00020003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00020003 (504 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Ambore... 99 4e-22 gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Ambore... 80 4e-13 ref|NP_064043.1| orf112a gene product (mitochondrion) [Beta vulg... 60 4e-07 ref|XP_012482084.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal pr... 58 3e-06 >gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Amborella trichopoda] Length = 131 Score = 98.6 bits (244), Expect(3) = 4e-22 Identities = 53/77 (68%), Positives = 55/77 (71%), Gaps = 3/77 (3%) Frame = +3 Query: 192 PSGVTFNT*CYVHAVIFYLSKSTTLYVVYVWGGRCGREVPHFDSRPVSISDPR*GITPLG 371 PS VT T CYVHAVI L KS T YVV VWG RCGREVP F+S PVSISDPR IT LG Sbjct: 23 PSRVTLVTFCYVHAVILSLPKSITPYVVAVWGDRCGREVPQFNSHPVSISDPRSRITRLG 82 Query: 372 LF---GPEPAGNGPTYL 413 LF + AGNGPTYL Sbjct: 83 LFFVRSQQVAGNGPTYL 99 Score = 31.6 bits (70), Expect(3) = 4e-22 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 460 GCYQDDFFMPIKEPR 504 G YQDDFFMPIK PR Sbjct: 113 GGYQDDFFMPIKGPR 127 Score = 21.2 bits (43), Expect(3) = 4e-22 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 410 PCLWTSCRANLCSIGLM 460 P S R+++CSIGL+ Sbjct: 96 PTYLVSSRSHICSIGLV 112 >gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = -3 Query: 190 SK*SKAENCCSLERRSAEVVPTIEVRVWD*AFRMIKTNKFFVSLVEPTPISY 35 S+ SKAENCCSLER S E +PT EVRVWD AF+MIKT KFFVSL+EP ISY Sbjct: 60 SQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIKTQKFFVSLIEPMQISY 111 >ref|NP_064043.1| orf112a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9049343|dbj|BAA99353.1| orf112a (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 112 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 400 PLPAGSGPKRPNGVIPYLGSEMLTGRESKWGTSLP 296 P+PAGS ++ NG+IPYL SEMLTGRESKWGTSLP Sbjct: 49 PIPAGSLTEKTNGLIPYLESEMLTGRESKWGTSLP 83 >ref|XP_012482084.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S14, mitochondrial [Gossypium raimondii] Length = 164 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -1 Query: 504 SRFFDGHKEIVLVATIKPIEQRLALQLVHKQGK 406 SR FDGHKEIVLVAT KPIEQ LA QLVHKQGK Sbjct: 132 SRSFDGHKEIVLVATTKPIEQGLAPQLVHKQGK 164