BLASTX nr result
ID: Cinnamomum23_contig00019726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00019726 (508 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009389543.1| PREDICTED: novel plant SNARE 13-like [Musa a... 59 2e-06 ref|XP_010943867.1| PREDICTED: novel plant SNARE 13 [Elaeis guin... 57 6e-06 ref|XP_006840320.1| PREDICTED: novel plant SNARE 13 [Amborella t... 56 8e-06 >ref|XP_009389543.1| PREDICTED: novel plant SNARE 13-like [Musa acuminata subsp. malaccensis] Length = 270 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 506 VVNPNNKDIRDIPGLAPPAPTSRRLLSRKSMGA 408 VVNPNNK+IRDIPGLAPPAPT+RRLLS ++ G+ Sbjct: 236 VVNPNNKNIRDIPGLAPPAPTARRLLSAEAFGS 268 >ref|XP_010943867.1| PREDICTED: novel plant SNARE 13 [Elaeis guineensis] Length = 270 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 506 VVNPNNKDIRDIPGLAPPAPTSRRLLSRKSMGAF 405 +VNP+NKDIRDIPGLAPPAPT+RRLLS ++ F Sbjct: 236 IVNPHNKDIRDIPGLAPPAPTARRLLSLEAFKGF 269 >ref|XP_006840320.1| PREDICTED: novel plant SNARE 13 [Amborella trichopoda] gi|548842038|gb|ERN01995.1| hypothetical protein AMTR_s00045p00083360 [Amborella trichopoda] Length = 270 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 506 VVNPNNKDIRDIPGLAPPAPTSRRLLS 426 +VNP+NKDIRDIPGLAPPAPTSRRLLS Sbjct: 236 IVNPHNKDIRDIPGLAPPAPTSRRLLS 262