BLASTX nr result
ID: Cinnamomum23_contig00019591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00019591 (519 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012487510.1| PREDICTED: uncharacterized protein LOC105800... 74 5e-11 ref|XP_012487509.1| PREDICTED: uncharacterized protein LOC105800... 74 5e-11 ref|XP_010269489.1| PREDICTED: uncharacterized protein LOC104606... 74 5e-11 ref|XP_010269488.1| PREDICTED: CAP-Gly domain-containing linker ... 74 5e-11 ref|XP_008438879.1| PREDICTED: CAP-Gly domain-containing linker ... 71 2e-10 ref|XP_008438878.1| PREDICTED: CAP-Gly domain-containing linker ... 71 2e-10 ref|XP_007035571.1| Uveal autoantigen with coiled-coil domains a... 71 2e-10 ref|XP_007035569.1| Uveal autoantigen with coiled-coil domains a... 71 2e-10 ref|XP_007035568.1| Uveal autoantigen with coiled-coil domains a... 71 2e-10 ref|XP_004134206.1| PREDICTED: CAP-Gly domain-containing linker ... 71 2e-10 ref|XP_010259643.1| PREDICTED: uncharacterized protein LOC104598... 70 7e-10 ref|XP_010259642.1| PREDICTED: uncharacterized protein LOC104598... 70 7e-10 ref|XP_010259641.1| PREDICTED: uncharacterized protein LOC104598... 70 7e-10 ref|XP_010259639.1| PREDICTED: CAP-Gly domain-containing linker ... 70 7e-10 gb|KDO35984.1| hypothetical protein CISIN_1g032236mg [Citrus sin... 70 7e-10 ref|XP_006419596.1| hypothetical protein CICLE_v10006148mg [Citr... 70 7e-10 ref|XP_006419595.1| hypothetical protein CICLE_v10006148mg [Citr... 70 7e-10 ref|XP_007035570.1| Uveal autoantigen with coiled-coil domains a... 69 9e-10 ref|XP_011015212.1| PREDICTED: uncharacterized protein LOC105118... 69 2e-09 ref|XP_011015211.1| PREDICTED: uncharacterized protein LOC105118... 69 2e-09 >ref|XP_012487510.1| PREDICTED: uncharacterized protein LOC105800754 isoform X2 [Gossypium raimondii] Length = 120 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL+RIQGLKLDLQNWRSKL Sbjct: 19 KKENNTPVGSKIAELNESRAELLSRIQGLKLDLQNWRSKL 58 >ref|XP_012487509.1| PREDICTED: uncharacterized protein LOC105800754 isoform X1 [Gossypium raimondii] gi|763771408|gb|KJB38623.1| hypothetical protein B456_006G263400 [Gossypium raimondii] Length = 147 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL+RIQGLKLDLQNWRSKL Sbjct: 19 KKENNTPVGSKIAELNESRAELLSRIQGLKLDLQNWRSKL 58 >ref|XP_010269489.1| PREDICTED: uncharacterized protein LOC104606128 isoform X2 [Nelumbo nucifera] Length = 137 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 125 TKKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 +KKEN TPIGSKI++LNESRSELL+RIQGLK DLQNWRSKL Sbjct: 20 SKKENMTPIGSKISELNESRSELLSRIQGLKQDLQNWRSKL 60 >ref|XP_010269488.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform X1 [Nelumbo nucifera] Length = 148 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -2 Query: 125 TKKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 +KKEN TPIGSKI++LNESRSELL+RIQGLK DLQNWRSKL Sbjct: 20 SKKENMTPIGSKISELNESRSELLSRIQGLKQDLQNWRSKL 60 >ref|XP_008438879.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform X2 [Cucumis melo] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TPIGSKIT+LNESRSELL RIQ LK DLQNWRSKL Sbjct: 17 KKENLTPIGSKITELNESRSELLNRIQSLKQDLQNWRSKL 56 >ref|XP_008438878.1| PREDICTED: CAP-Gly domain-containing linker protein 1 isoform X1 [Cucumis melo] Length = 151 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TPIGSKIT+LNESRSELL RIQ LK DLQNWRSKL Sbjct: 17 KKENLTPIGSKITELNESRSELLNRIQSLKQDLQNWRSKL 56 >ref|XP_007035571.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 4, partial [Theobroma cacao] gi|508714600|gb|EOY06497.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 4, partial [Theobroma cacao] Length = 118 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL+RIQGLK DLQNWRSKL Sbjct: 19 KKENMTPVGSKIAELNESRTELLSRIQGLKQDLQNWRSKL 58 >ref|XP_007035569.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 2 [Theobroma cacao] gi|508714598|gb|EOY06495.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 2 [Theobroma cacao] Length = 146 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL+RIQGLK DLQNWRSKL Sbjct: 19 KKENMTPVGSKIAELNESRTELLSRIQGLKQDLQNWRSKL 58 >ref|XP_007035568.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 1 [Theobroma cacao] gi|508714597|gb|EOY06494.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 1 [Theobroma cacao] Length = 171 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL+RIQGLK DLQNWRSKL Sbjct: 19 KKENMTPVGSKIAELNESRTELLSRIQGLKQDLQNWRSKL 58 >ref|XP_004134206.1| PREDICTED: CAP-Gly domain-containing linker protein 1 [Cucumis sativus] Length = 150 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TPIGSKIT+LNESRSELL RIQ LK DLQNWRSKL Sbjct: 17 KKENLTPIGSKITELNESRSELLNRIQSLKQDLQNWRSKL 56 >ref|XP_010259643.1| PREDICTED: uncharacterized protein LOC104598988 isoform X5 [Nelumbo nucifera] Length = 122 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 125 TKKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 +KKEN TPI S+I +LNESRSELL+RIQGLK DLQNWRSKL Sbjct: 20 SKKENMTPISSRIAELNESRSELLSRIQGLKQDLQNWRSKL 60 >ref|XP_010259642.1| PREDICTED: uncharacterized protein LOC104598988 isoform X4 [Nelumbo nucifera] Length = 124 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 125 TKKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 +KKEN TPI S+I +LNESRSELL+RIQGLK DLQNWRSKL Sbjct: 20 SKKENMTPISSRIAELNESRSELLSRIQGLKQDLQNWRSKL 60 >ref|XP_010259641.1| PREDICTED: uncharacterized protein LOC104598988 isoform X3 [Nelumbo nucifera] Length = 146 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 125 TKKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 +KKEN TPI S+I +LNESRSELL+RIQGLK DLQNWRSKL Sbjct: 20 SKKENMTPISSRIAELNESRSELLSRIQGLKQDLQNWRSKL 60 >ref|XP_010259639.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform X1 [Nelumbo nucifera] Length = 148 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 125 TKKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 +KKEN TPI S+I +LNESRSELL+RIQGLK DLQNWRSKL Sbjct: 20 SKKENMTPISSRIAELNESRSELLSRIQGLKQDLQNWRSKL 60 >gb|KDO35984.1| hypothetical protein CISIN_1g032236mg [Citrus sinensis] Length = 144 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL RIQGLK DLQNWRSKL Sbjct: 14 KKENITPVGSKIAELNESRAELLNRIQGLKQDLQNWRSKL 53 >ref|XP_006419596.1| hypothetical protein CICLE_v10006148mg [Citrus clementina] gi|568871864|ref|XP_006489100.1| PREDICTED: uncharacterized protein LOC102621728 isoform X1 [Citrus sinensis] gi|557521469|gb|ESR32836.1| hypothetical protein CICLE_v10006148mg [Citrus clementina] Length = 151 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL RIQGLK DLQNWRSKL Sbjct: 21 KKENITPVGSKIAELNESRAELLNRIQGLKQDLQNWRSKL 60 >ref|XP_006419595.1| hypothetical protein CICLE_v10006148mg [Citrus clementina] gi|567852867|ref|XP_006419597.1| hypothetical protein CICLE_v10006148mg [Citrus clementina] gi|557521468|gb|ESR32835.1| hypothetical protein CICLE_v10006148mg [Citrus clementina] gi|557521470|gb|ESR32837.1| hypothetical protein CICLE_v10006148mg [Citrus clementina] Length = 149 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKEN TP+GSKI +LNESR+ELL RIQGLK DLQNWRSKL Sbjct: 19 KKENITPVGSKIAELNESRAELLNRIQGLKQDLQNWRSKL 58 >ref|XP_007035570.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 3 [Theobroma cacao] gi|508714599|gb|EOY06496.1| Uveal autoantigen with coiled-coil domains and ankyrin repeats isoform 3 [Theobroma cacao] Length = 145 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 119 KENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KEN TP+GSKI +LNESR+ELL+RIQGLK DLQNWRSKL Sbjct: 19 KENMTPVGSKIAELNESRTELLSRIQGLKQDLQNWRSKL 57 >ref|XP_011015212.1| PREDICTED: uncharacterized protein LOC105118855 isoform X2 [Populus euphratica] Length = 146 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKE+ TPIGSKIT+LNESR+ELL RIQGLK DLQ+WRSKL Sbjct: 20 KKEDVTPIGSKITELNESRTELLNRIQGLKQDLQSWRSKL 59 >ref|XP_011015211.1| PREDICTED: uncharacterized protein LOC105118855 isoform X1 [Populus euphratica] Length = 148 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -2 Query: 122 KKENQTPIGSKITDLNESRSELLTRIQGLKLDLQNWRSKL 3 KKE+ TPIGSKIT+LNESR+ELL RIQGLK DLQ+WRSKL Sbjct: 20 KKEDVTPIGSKITELNESRTELLNRIQGLKQDLQSWRSKL 59