BLASTX nr result
ID: Cinnamomum23_contig00019410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00019410 (284 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457824.1| hypothetical protein SORBIDRAFT_03g014426 [S... 60 4e-07 ref|XP_002457820.1| hypothetical protein SORBIDRAFT_03g014390 [S... 58 3e-06 ref|XP_010269796.1| PREDICTED: putative disease resistance prote... 57 4e-06 >ref|XP_002457824.1| hypothetical protein SORBIDRAFT_03g014426 [Sorghum bicolor] gi|241929799|gb|EES02944.1| hypothetical protein SORBIDRAFT_03g014426, partial [Sorghum bicolor] Length = 1619 Score = 60.5 bits (145), Expect = 4e-07 Identities = 35/77 (45%), Positives = 47/77 (61%) Frame = -2 Query: 283 LSNFIVGRTNEIACSGIGELQGLNHLRGRLKIQLLKNITDAIDVPRDTLINKPNLTSLDL 104 L+NF+VG + CS IGELQ LN+L G L++ L+N+T+AID L NK LT+L L Sbjct: 675 LTNFVVGTGPD--CSSIGELQHLNNLSGSLQLSKLENVTEAIDAKMAHLENKKELTALSL 732 Query: 103 MWDDFVEVEFGTSEEDR 53 W T+EED+ Sbjct: 733 RWT--------TTEEDK 741 >ref|XP_002457820.1| hypothetical protein SORBIDRAFT_03g014390 [Sorghum bicolor] gi|241929795|gb|EES02940.1| hypothetical protein SORBIDRAFT_03g014390 [Sorghum bicolor] Length = 1215 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/62 (50%), Positives = 40/62 (64%) Frame = -2 Query: 283 LSNFIVGRTNEIACSGIGELQGLNHLRGRLKIQLLKNITDAIDVPRDTLINKPNLTSLDL 104 L+NF+VG + CS IGELQ LN+L G L + L+N+T+AID L NK LT+L L Sbjct: 442 LTNFVVGTGPD--CSSIGELQHLNNLSGSLVLSQLENVTEAIDAKMAHLENKKELTALSL 499 Query: 103 MW 98 W Sbjct: 500 RW 501 >ref|XP_010269796.1| PREDICTED: putative disease resistance protein RGA3 [Nelumbo nucifera] Length = 1358 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/65 (46%), Positives = 43/65 (66%) Frame = -2 Query: 283 LSNFIVGRTNEIACSGIGELQGLNHLRGRLKIQLLKNITDAIDVPRDTLINKPNLTSLDL 104 L+ FIVG+ + + ELQ LN LRG+L+I+ L+N+++A+D R L NKPNL L+L Sbjct: 772 LTKFIVGKEDGRT---LAELQDLNSLRGQLRIESLENVSNAVDAVRANLKNKPNLCRLEL 828 Query: 103 MWDDF 89 W F Sbjct: 829 CWGYF 833