BLASTX nr result
ID: Cinnamomum23_contig00019326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00019326 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005643207.1| hypothetical protein COCSUDRAFT_45149 [Cocco... 93 6e-17 ref|WP_036806351.1| thioredoxin peroxidase [Polaromonas sp. CG9_12] 69 1e-09 emb|CDS51574.1| Conserved domain protein [Polaromonas sp. CG9_12] 69 1e-09 ref|WP_023432443.1| hypothetical protein [Lutibaculum baratangen... 69 1e-09 ref|WP_023604676.1| thioredoxin peroxidase [Aliivibrio logei] 69 2e-09 ref|WP_021815131.1| hypothetical protein [Psychrobacter aquaticu... 68 3e-09 ref|WP_025056935.1| thioredoxin peroxidase [Sulfitobacter noctil... 67 5e-09 ref|WP_024575394.1| MULTISPECIES: thioredoxin peroxidase [Afipia] 66 1e-08 ref|WP_029216061.1| thioredoxin peroxidase [Pseudoalteromonas ha... 65 2e-08 ref|WP_011513588.1| thioredoxin peroxidase [Psychrobacter cryoha... 65 2e-08 ref|WP_020443461.1| thioredoxin peroxidase [Psychrobacter sp. G]... 65 2e-08 ref|WP_040728426.1| thioredoxin peroxidase [Oxalobacteraceae bac... 64 4e-08 ref|WP_037921439.1| thioredoxin peroxidase [Sulfitobacter pseudo... 64 4e-08 ref|WP_025062728.1| thioredoxin peroxidase [Sulfitobacter guttif... 64 4e-08 ref|WP_009824924.1| thioredoxin peroxidase [Sulfitobacter sp. NA... 64 4e-08 ref|WP_005854133.1| MULTISPECIES: thioredoxin peroxidase [Sulfit... 64 4e-08 gb|EGF30123.1| Conserved domain protein [Oxalobacteraceae bacter... 64 4e-08 ref|WP_040485638.1| thioredoxin peroxidase [Lutibaculum baratang... 64 5e-08 gb|ESR24625.1| hypothetical protein N177_2305 [Lutibaculum barat... 64 5e-08 ref|WP_025053391.1| thioredoxin peroxidase [Sulfitobacter noctil... 63 7e-08 >ref|XP_005643207.1| hypothetical protein COCSUDRAFT_45149 [Coccomyxa subellipsoidea C-169] gi|384245168|gb|EIE18663.1| hypothetical protein COCSUDRAFT_45149 [Coccomyxa subellipsoidea C-169] Length = 278 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRGMFG 155 ALFLLNPDGE+ I+DYSNSPFARPDLRILVEGIRYIQENDYPVRG +G Sbjct: 229 ALFLLNPDGEVIIIDYSNSPFARPDLRILVEGIRYIQENDYPVRGTYG 276 >ref|WP_036806351.1| thioredoxin peroxidase [Polaromonas sp. CG9_12] Length = 171 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 +F++NP G++QIVD SN+PFARPDLR L++GIR++ E DYPVRG Sbjct: 126 VFVINPRGQVQIVDVSNAPFARPDLRALLDGIRFVIEKDYPVRG 169 >emb|CDS51574.1| Conserved domain protein [Polaromonas sp. CG9_12] Length = 136 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 +F++NP G++QIVD SN+PFARPDLR L++GIR++ E DYPVRG Sbjct: 91 VFVINPRGQVQIVDVSNAPFARPDLRALLDGIRFVIEKDYPVRG 134 >ref|WP_023432443.1| hypothetical protein [Lutibaculum baratangense] gi|557404492|gb|ESR24634.1| hypothetical protein N177_2314 [Lutibaculum baratangense AMV1] Length = 172 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/47 (59%), Positives = 41/47 (87%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRGMFG 155 LF++NP+G LQIVD SN+PF+RPDL +L++G+++IQE +YP+RG G Sbjct: 126 LFVVNPEGRLQIVDVSNAPFSRPDLGMLLKGLKFIQEKNYPIRGTHG 172 >ref|WP_023604676.1| thioredoxin peroxidase [Aliivibrio logei] Length = 194 Score = 68.6 bits (166), Expect = 2e-09 Identities = 26/50 (52%), Positives = 42/50 (84%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRGMFGLR 149 ALF++N +G +QI+D SN+PFARPD+ ++ GI++I+EN+YP+RG + +R Sbjct: 141 ALFIINSEGRVQIIDISNAPFARPDINSILSGIKFIRENNYPIRGTYNVR 190 >ref|WP_021815131.1| hypothetical protein [Psychrobacter aquaticus] gi|545673016|gb|ERL54371.1| hypothetical protein M917_2519 [Psychrobacter aquaticus CMS 56] Length = 178 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRGMFG 155 A+F++N DG +QIVD SN+PFARP+L L G+ +I+ENDYP+RG G Sbjct: 131 AVFVINADGNIQIVDISNAPFARPELEALANGLSFIRENDYPIRGTHG 178 >ref|WP_025056935.1| thioredoxin peroxidase [Sulfitobacter noctilucicola] gi|751943636|gb|KIN64588.1| Thioredoxin peroxidase [Sulfitobacter noctilucicola] Length = 174 Score = 67.0 bits (162), Expect = 5e-09 Identities = 26/44 (59%), Positives = 39/44 (88%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 LF++N +G++QI+D SN+PFARPDL LV G+++++ENDYP+RG Sbjct: 126 LFVVNGEGKIQIIDISNAPFARPDLSSLVNGVKFVRENDYPIRG 169 >ref|WP_024575394.1| MULTISPECIES: thioredoxin peroxidase [Afipia] Length = 172 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRGMFG 155 LF +NP+ +LQIVD SN+PFARPDL +++G+++IQE YP+RG G Sbjct: 126 LFAINPERKLQIVDVSNAPFARPDLAAILKGLKFIQEKQYPIRGTLG 172 >ref|WP_029216061.1| thioredoxin peroxidase [Pseudoalteromonas haloplanktis] Length = 175 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/45 (57%), Positives = 38/45 (84%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 A+F+LN ++QI+D SN+PF+RPDL L+ GI++I+ENDYP+RG Sbjct: 127 AIFVLNEQNQIQILDKSNAPFSRPDLNALLSGIKFIRENDYPIRG 171 >ref|WP_011513588.1| thioredoxin peroxidase [Psychrobacter cryohalolentis] gi|92393761|gb|ABE75036.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Psychrobacter cryohalolentis K5] Length = 178 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 +F++N DGE+QIVD SN+PFARP+L L G+ +I++NDYP+RG Sbjct: 132 VFVVNADGEIQIVDISNAPFARPELEALANGLAFIRKNDYPIRG 175 >ref|WP_020443461.1| thioredoxin peroxidase [Psychrobacter sp. G] gi|521015785|gb|AGP48845.1| thioredoxin peroxidase [Psychrobacter sp. G] Length = 178 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 +F++N DGE+QIVD SN+PFARP+L L G+ +I++NDYP+RG Sbjct: 132 VFVVNADGEIQIVDISNAPFARPELEALANGLAFIRKNDYPIRG 175 >ref|WP_040728426.1| thioredoxin peroxidase [Oxalobacteraceae bacterium IMCC9480] Length = 171 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/45 (55%), Positives = 38/45 (84%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 A+F++NP G++QIVD SN+PFARPDL L++G+++I + YP+RG Sbjct: 125 AIFVINPQGQIQIVDISNAPFARPDLASLLQGLKFILDKGYPIRG 169 >ref|WP_037921439.1| thioredoxin peroxidase [Sulfitobacter pseudonitzschiae] gi|659675100|gb|KEJ98071.1| thioredoxin peroxidase [Sulfitobacter pseudonitzschiae] Length = 175 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -3 Query: 292 FLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 F++N DG LQIVD SN+PFARPDL L+ GI +++E DYPVRG Sbjct: 128 FVVNGDGNLQIVDVSNAPFARPDLDALLRGITFVREKDYPVRG 170 >ref|WP_025062728.1| thioredoxin peroxidase [Sulfitobacter guttiformis] gi|751952173|gb|KIN73086.1| Thioredoxin peroxidase [Sulfitobacter guttiformis KCTC 32187] Length = 174 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/46 (54%), Positives = 37/46 (80%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRGMF 158 +F++N +G +QI+D SN+PFARPDL L GI++++ NDYP+RG F Sbjct: 127 VFVINAEGAVQIIDVSNAPFARPDLEGLANGIKFVRNNDYPIRGTF 172 >ref|WP_009824924.1| thioredoxin peroxidase [Sulfitobacter sp. NAS-14.1] gi|83841929|gb|EAP81098.1| thioredoxin peroxidase [Sulfitobacter sp. NAS-14.1] Length = 175 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/44 (56%), Positives = 38/44 (86%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 +F++N DG +QI+D SN+PFARPDL L+ GI+++++NDYP+RG Sbjct: 127 VFVVNGDGNIQILDISNAPFARPDLEGLLNGIKFVRDNDYPIRG 170 >ref|WP_005854133.1| MULTISPECIES: thioredoxin peroxidase [Sulfitobacter] gi|83846838|gb|EAP84714.1| thioredoxin peroxidase [Sulfitobacter sp. EE-36] gi|618796209|gb|KAJ31211.1| thioredoxin peroxidase [Sulfitobacter pontiacus 3SOLIMAR09] gi|668745406|gb|KFC26619.1| thioredoxin peroxidase [Sulfitobacter sp. CB2047] Length = 175 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/44 (56%), Positives = 38/44 (86%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 +F++N DG +QI+D SN+PFARPDL L+ GI+++++NDYP+RG Sbjct: 127 VFVVNGDGNIQILDISNAPFARPDLEGLLNGIKFVRDNDYPIRG 170 >gb|EGF30123.1| Conserved domain protein [Oxalobacteraceae bacterium IMCC9480] Length = 166 Score = 63.9 bits (154), Expect = 4e-08 Identities = 25/45 (55%), Positives = 38/45 (84%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 A+F++NP G++QIVD SN+PFARPDL L++G+++I + YP+RG Sbjct: 120 AIFVINPQGQIQIVDISNAPFARPDLASLLQGLKFILDKGYPIRG 164 >ref|WP_040485638.1| thioredoxin peroxidase [Lutibaculum baratangense] Length = 172 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 LF+ NP G LQIVD SN+PFARPDL+ +++G+++IQE YP+RG Sbjct: 126 LFVTNPGGVLQIVDISNAPFARPDLQGVLDGLKFIQEKHYPIRG 169 >gb|ESR24625.1| hypothetical protein N177_2305 [Lutibaculum baratangense AMV1] Length = 136 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -3 Query: 295 LFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 LF+ NP G LQIVD SN+PFARPDL+ +++G+++IQE YP+RG Sbjct: 90 LFVTNPGGVLQIVDISNAPFARPDLQGVLDGLKFIQEKHYPIRG 133 >ref|WP_025053391.1| thioredoxin peroxidase [Sulfitobacter noctilucae] gi|751940547|gb|KIN61499.1| Thioredoxin peroxidase [Sulfitobacter noctilucae] Length = 174 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = -3 Query: 298 ALFLLNPDGELQIVDYSNSPFARPDLRILVEGIRYIQENDYPVRG 164 A+F++N G +QI+D SN+PFARPDL+ L GI++++ NDYPVRG Sbjct: 125 AVFVVNGQGNIQILDVSNAPFARPDLQSLANGIKFVRANDYPVRG 169