BLASTX nr result
ID: Cinnamomum23_contig00018669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00018669 (207 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP20462.1| hypothetical protein JCGZ_06007 [Jatropha curcas] 75 2e-11 ref|XP_003851048.1| hypothetical protein MYCGRDRAFT_74254, parti... 60 4e-07 ref|XP_007929417.1| hypothetical protein MYCFIDRAFT_141089, part... 58 3e-06 ref|XP_001383614.1| hypothetical protein PICST_57317 [Schefferso... 57 4e-06 >gb|KDP20462.1| hypothetical protein JCGZ_06007 [Jatropha curcas] Length = 117 Score = 74.7 bits (182), Expect = 2e-11 Identities = 39/49 (79%), Positives = 39/49 (79%) Frame = +2 Query: 2 ERLIEPSSSWFLPKFPSG*Q*RFQFYEVKRMIRGLGVETTLTYSQTLNM 148 ER IE SSSWFL KFPSG Q QFYEVKRMIRGLG ET TYSQTLNM Sbjct: 69 ERPIEASSSWFLSKFPSGKQYGTQFYEVKRMIRGLGGETPFTYSQTLNM 117 >ref|XP_003851048.1| hypothetical protein MYCGRDRAFT_74254, partial [Zymoseptoria tritici IPO323] gi|398395191|ref|XP_003851054.1| hypothetical protein MYCGRDRAFT_74248, partial [Zymoseptoria tritici IPO323] gi|339470927|gb|EGP86024.1| hypothetical protein MYCGRDRAFT_74254, partial [Zymoseptoria tritici IPO323] gi|339470933|gb|EGP86030.1| hypothetical protein MYCGRDRAFT_74248, partial [Zymoseptoria tritici IPO323] Length = 88 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -2 Query: 206 PTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 99 PTSNDTFKCPR LLTYLKFENRLRLFQPQGL Sbjct: 59 PTSNDTFKCPR------LLTYLKFENRLRLFQPQGL 88 >ref|XP_007929417.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora fijiensis CIRAD86] gi|452980741|gb|EME80502.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora fijiensis CIRAD86] Length = 88 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/36 (80%), Positives = 29/36 (80%) Frame = -2 Query: 206 PTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 99 PTSN TFKCPR LLTYLKFENRLRLFQPQGL Sbjct: 59 PTSNGTFKCPR------LLTYLKFENRLRLFQPQGL 88 >ref|XP_001383614.1| hypothetical protein PICST_57317 [Scheffersomyces stipitis CBS 6054] gi|126095763|gb|ABN65585.1| predicted protein, partial [Scheffersomyces stipitis CBS 6054] Length = 94 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -2 Query: 206 PTSNDTFKCPRSTK*QGLLTYLKFENRLRLFQPQGL 99 PT + +F CPRS K QGLLTYLKFENRLR FQPQ L Sbjct: 59 PTKSSSFICPRSIKQQGLLTYLKFENRLRSFQPQDL 94