BLASTX nr result
ID: Cinnamomum23_contig00018251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00018251 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009777616.1| PREDICTED: BTB/POZ domain-containing protein... 68 2e-09 ref|XP_009632024.1| PREDICTED: BTB/POZ domain-containing protein... 68 2e-09 ref|XP_010061411.1| PREDICTED: BTB/POZ domain-containing protein... 68 2e-09 gb|KCW68348.1| hypothetical protein EUGRSUZ_F02008 [Eucalyptus g... 68 2e-09 gb|KHN31699.1| BTB/POZ domain-containing protein [Glycine soja] 68 3e-09 ref|XP_007146672.1| hypothetical protein PHAVU_006G059800g [Phas... 68 3e-09 gb|AFK49561.1| unknown [Lotus japonicus] 68 3e-09 ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein... 68 3e-09 ref|XP_012444070.1| PREDICTED: BTB/POZ domain-containing protein... 67 6e-09 ref|XP_006586164.1| PREDICTED: BTB/POZ domain-containing protein... 67 6e-09 ref|XP_003532194.1| PREDICTED: BTB/POZ domain-containing protein... 67 6e-09 gb|KHG28422.1| hypothetical protein F383_10833 [Gossypium arboreum] 66 8e-09 ref|XP_010252868.1| PREDICTED: BTB/POZ domain-containing protein... 66 8e-09 ref|XP_009339283.1| PREDICTED: BTB/POZ domain-containing protein... 66 8e-09 ref|XP_008353274.1| PREDICTED: BTB/POZ domain-containing protein... 66 8e-09 ref|XP_008353266.1| PREDICTED: BTB/POZ domain-containing protein... 66 8e-09 ref|XP_008218921.1| PREDICTED: BTB/POZ domain-containing protein... 66 8e-09 emb|CBI39826.3| unnamed protein product [Vitis vinifera] 66 8e-09 ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein... 66 8e-09 ref|XP_007205531.1| hypothetical protein PRUPE_ppa008513mg [Prun... 66 8e-09 >ref|XP_009777616.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Nicotiana sylvestris] Length = 328 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRV+T PRLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_009632024.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Nicotiana tomentosiformis] Length = 328 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRV+T PRLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_010061411.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Eucalyptus grandis] gi|629102880|gb|KCW68349.1| hypothetical protein EUGRSUZ_F02008 [Eucalyptus grandis] Length = 329 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRV+T PRLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKI 35 >gb|KCW68348.1| hypothetical protein EUGRSUZ_F02008 [Eucalyptus grandis] Length = 326 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRV+T PRLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKI 35 >gb|KHN31699.1| BTB/POZ domain-containing protein [Glycine soja] Length = 328 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET PRLAQW+I++LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTPRLAQWRIENLASCTYRKSDPFKI 35 >ref|XP_007146672.1| hypothetical protein PHAVU_006G059800g [Phaseolus vulgaris] gi|561019895|gb|ESW18666.1| hypothetical protein PHAVU_006G059800g [Phaseolus vulgaris] Length = 328 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET PRLAQW+I++LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTPRLAQWRIENLASCTYRKSDPFKI 35 >gb|AFK49561.1| unknown [Lotus japonicus] Length = 328 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET PRLAQW+I++LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTPRLAQWRIENLASCTYRKSDPFKI 35 >ref|XP_003551376.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Glycine max] Length = 328 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET PRLAQW+I++LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTPRLAQWRIENLASCTYRKSDPFKI 35 >ref|XP_012444070.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Gossypium raimondii] gi|763796099|gb|KJB63095.1| hypothetical protein B456_009G453000 [Gossypium raimondii] Length = 328 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 119 SRMSTSDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SRMS DSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SRMS--DSAYRVETTARLAQWRIDNLASCTYRKSDPFKI 38 >ref|XP_006586164.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X2 [Glycine max] Length = 320 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRV+T PRLAQW+I++LASCTYRKSDPFKI Sbjct: 2 SDSAYRVQTTPRLAQWRIENLASCTYRKSDPFKI 35 >ref|XP_003532194.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X1 [Glycine max] gi|734314795|gb|KHN01823.1| BTB/POZ domain-containing protein [Glycine soja] Length = 328 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRV+T PRLAQW+I++LASCTYRKSDPFKI Sbjct: 2 SDSAYRVQTTPRLAQWRIENLASCTYRKSDPFKI 35 >gb|KHG28422.1| hypothetical protein F383_10833 [Gossypium arboreum] Length = 325 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTARLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_010252868.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Nelumbo nucifera] Length = 325 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_009339283.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Pyrus x bretschneideri] Length = 328 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_008353274.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 isoform X2 [Malus domestica] gi|658038950|ref|XP_008355041.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X2 [Malus domestica] Length = 328 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_008353266.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 isoform X1 [Malus domestica] gi|658038948|ref|XP_008355040.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like isoform X1 [Malus domestica] Length = 332 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_008218921.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Prunus mume] Length = 328 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >emb|CBI39826.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_004294912.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Fragaria vesca subsp. vesca] Length = 328 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_007205531.1| hypothetical protein PRUPE_ppa008513mg [Prunus persica] gi|462401173|gb|EMJ06730.1| hypothetical protein PRUPE_ppa008513mg [Prunus persica] Length = 328 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 104 SDSAYRVETAPRLAQWKIDSLASCTYRKSDPFKI 3 SDSAYRVET RLAQW+ID+LASCTYRKSDPFKI Sbjct: 2 SDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35