BLASTX nr result
ID: Cinnamomum23_contig00018085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00018085 (373 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842618.1| PREDICTED: UDP-galactose transporter 2 [Ambo... 57 4e-06 >ref|XP_006842618.1| PREDICTED: UDP-galactose transporter 2 [Amborella trichopoda] gi|769814263|ref|XP_011622707.1| PREDICTED: UDP-galactose transporter 2 [Amborella trichopoda] gi|548844704|gb|ERN04293.1| hypothetical protein AMTR_s00077p00178780 [Amborella trichopoda] Length = 333 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 279 MAHASKADKKAALDIASWMFNVVTSVGIIIV 371 MA ASKAD+KAALD+ASWMFNVVTSVGIIIV Sbjct: 1 MAPASKADRKAALDVASWMFNVVTSVGIIIV 31