BLASTX nr result
ID: Cinnamomum23_contig00018082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00018082 (206 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ07831.1| hypothetical protein OsI_30090 [Oryza sativa Indi... 57 6e-06 ref|XP_006649935.1| PREDICTED: probably inactive leucine-rich re... 56 8e-06 >gb|EAZ07831.1| hypothetical protein OsI_30090 [Oryza sativa Indica Group] Length = 940 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = -1 Query: 167 VLDLSYNNLGGVLPNVFASPFLKWLQLSHNNLSGVLPALIGVQSSLFALDLSGN 6 VLDLS+NNL G LP F L++L LSHN+LSGV+PA + S+ +D+S N Sbjct: 517 VLDLSHNNLSGSLPQSFGDKELQYLSLSHNSLSGVIPAYLCDMISMELIDISNN 570 >ref|XP_006649935.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Oryza brachyantha] Length = 791 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -1 Query: 170 FVLDLSYNNLGGVLPNVFAS-PFLKWLQLSHNNLSGVLPALIGVQSSLFALDLSGN 6 F L+L+YNNL G +P+ AS PFL LQLS+NNLSG +PA IG L L LS N Sbjct: 160 FRLNLAYNNLSGAVPSSLASLPFLMSLQLSNNNLSGEVPATIGNLRMLHELSLSNN 215