BLASTX nr result
ID: Cinnamomum23_contig00017793
seq
BLASTX 2.2.25 [Feb-01-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Cinnamomum23_contig00017793
(443 letters)
Database: ./nr
69,698,275 sequences; 24,982,196,650 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomen... 81 3e-13
ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicot... 77 3e-12
emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum] 76 8e-12
ref|NP_039364.1| photosystem II protein I [Oryza sativa Japonica... 62 1e-07
dbj|BAF42779.2| photosystem II protein I [Brassica oleracea var.... 62 2e-07
ref|NP_051043.1| photosystem II protein I [Arabidopsis thaliana]... 60 4e-07
ref|YP_009130823.1| photosystem II protein I (chloroplast) [Goss... 60 4e-07
ref|YP_009129764.1| photosystem II protein I (chloroplast) [Vani... 60 4e-07
ref|YP_009114853.1| photosystem II protein I [Thalictrum coreanu... 60 4e-07
gb|KGN61622.1| hypothetical protein Csa_2G190790 [Cucumis sativus] 60 4e-07
gb|AGQ50340.1| photosystem II protein I (chloroplast) [Rumex ace... 60 4e-07
emb|CDY71758.1| BnaCnng74310D [Brassica napus] 60 4e-07
ref|YP_009054820.1| photosystem II protein I (chloroplast) [Trit... 60 4e-07
ref|YP_009048183.1| photosystem II protein I (chloroplast) [Cala... 60 4e-07
ref|YP_009048094.1| photosystem II protein I (chloroplast) [Prim... 60 4e-07
ref|YP_009045550.1| photosystem II protein I (chloroplast) [Cypr... 60 4e-07
ref|YP_009041071.1| photosystem II protein I [Rhazya stricta] gi... 60 4e-07
ref|YP_003540915.1| photosystem II protein I [Phoenix dactylifer... 60 4e-07
gb|ADD30672.1| photosystem II protein I (chloroplast) [Meliosma ... 60 4e-07
ref|YP_002720022.1| photosystem II protein I [Nicotiana tabacum] 60 4e-07
>ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomentosiformis]
gi|80750905|dbj|BAE47981.1| hypothetical protein
[Nicotiana tomentosiformis]
Length = 90
Score = 80.9 bits (198), Expect = 3e-13
Identities = 54/88 (61%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
Frame = -3
Query: 390 MIQDVILDVMNKKIRGFSLLDF*IFLGFSFSIPY-I*L*ERGLEIFSNSKGKYQVIRRNG 214
MI DVILDV NK RGF L F FS+ + Y L + + F N K K QVI NG
Sbjct: 1 MIPDVILDVKNKIKRGFPCLIF----KFSYDLVYSTHLTKNKNKGFRNLKKKNQVI--NG 54
Query: 213 ERGIRTLGTNNSYNGLAIRRFSPLSHLS 130
+RGIRTLGT NSYNGLAIRRFSPLSHLS
Sbjct: 55 KRGIRTLGTINSYNGLAIRRFSPLSHLS 82
>ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicotiana undulata]
gi|347453885|gb|AEO95543.1| hypothetical protein
(chloroplast) [Nicotiana undulata]
gi|347453996|gb|AEO95653.1| hypothetical protein
[synthetic construct]
Length = 90
Score = 77.4 bits (189), Expect = 3e-12
Identities = 52/88 (59%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
Frame = -3
Query: 390 MIQDVILDVMNKKIRGFSLLDF*IFLGFSFSIPY-I*L*ERGLEIFSNSKGKYQVIRRNG 214
MI DVILDV NK+ R F L F FS+ + Y L + + F N K K QV NG
Sbjct: 1 MIPDVILDVKNKRKRVFPCLIF----QFSYDLVYSTHLTKNKNKGFRNLKKKNQV--SNG 54
Query: 213 ERGIRTLGTNNSYNGLAIRRFSPLSHLS 130
+RGIRTLGT NSYNGLAIRRFSPLSHLS
Sbjct: 55 KRGIRTLGTINSYNGLAIRRFSPLSHLS 82
>emb|CAJ32479.1| hypothetical protein [Nicotiana tabacum]
Length = 90
Score = 76.3 bits (186), Expect = 8e-12
Identities = 52/88 (59%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
Frame = -3
Query: 390 MIQDVILDVMNKKIRGFSLLDF*IFLGFSFSIPY-I*L*ERGLEIFSNSKGKYQVIRRNG 214
MI DVILDV NK + F L F FS+ + Y L + + F N K K QVI NG
Sbjct: 1 MIPDVILDVKNKIKKVFPCLIF----QFSYDLVYSTHLTKNKNKGFRNLKKKNQVI--NG 54
Query: 213 ERGIRTLGTNNSYNGLAIRRFSPLSHLS 130
+RGIRTLGT NSYNGLAIRRFSPLSHLS
Sbjct: 55 KRGIRTLGTINSYNGLAIRRFSPLSHLS 82
>ref|NP_039364.1| photosystem II protein I [Oryza sativa Japonica Group]
gi|34500898|ref|NP_904083.1| photosystem II protein I
[Amborella trichopoda] gi|50233952|ref|YP_052730.1|
photosystem II protein I (chloroplast) [Oryza nivara]
gi|109156583|ref|YP_654202.1| photosystem II protein I
(chloroplast) [Oryza sativa Indica Group]
gi|374249251|ref|YP_005087994.1| psbI gene product
[Leersia tisserantii] gi|374249604|ref|YP_005089131.1|
psbI gene product [Rhynchoryza subulata]
gi|378758399|ref|YP_005296403.1| psbI gene product
(chloroplast) [Oryza meridionalis]
gi|386799155|ref|YP_006280744.1| psbI gene product
(chloroplast) [Oryza rufipogon]
gi|649132468|ref|YP_009034081.1| photosystem II protein
I (plastid) [Oryza glaberrima]
gi|669136029|ref|YP_009049253.1| photosystem II protein
I (chloroplast) [Oryza australiensis]
gi|817525573|ref|YP_009135593.1| photosystem II protein
I (plastid) [Zizania aquatica]
gi|827046171|ref|YP_009142473.1| photosystem II protein
I (chloroplast) [Chikusichloa aquatica]
gi|884997761|ref|YP_009155525.1| photosystem II protein
I (chloroplast) [Oryza barthii]
gi|884997844|ref|YP_009155607.1| photosystem II protein
I (chloroplast) [Oryza glumipatula]
gi|884997928|ref|YP_009155690.1| photosystem II protein
I (chloroplast) [Oryza longistaminata]
gi|884998012|ref|YP_009155773.1| photosystem II protein
I (chloroplast) [Oryza officinalis]
gi|61214954|sp|Q6ENJ3.1|PSBI_ORYNI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|68052633|sp|Q70Y13.1|PSBI_AMBTC RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|148887137|sp|P0C405.1|PSBI_ORYSA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|148887138|sp|P0C406.1|PSBI_ORYSI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|148887139|sp|P0C407.1|PSBI_ORYSJ RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|18855002|gb|AAL79694.1|AC087599_13 photosystem II
reaction center I protein (PSII-I) [Oryza sativa
Japonica Group] gi|11962|emb|CAA34011.1| PSII I protein
(chloroplast) [Oryza sativa Japonica Group]
gi|34481613|emb|CAD45093.1| unnamed protein product
[Amborella trichopoda] gi|42795475|gb|AAS46042.1|
photosystem II protein I (chloroplast) [Oryza sativa
Indica Group] gi|42795541|gb|AAS46107.1| photosystem II
protein I (chloroplast) [Oryza sativa Japonica Group]
gi|42795605|gb|AAS46170.1| photosystem II protein I
(chloroplast) [Oryza sativa Japonica Group]
gi|49614976|dbj|BAD26759.1| PSII I protein (chloroplast)
[Oryza nivara] gi|290790560|gb|ADD62820.1| photosystem
II protein I (chloroplast) [Oryza sativa Japonica Group]
gi|290790629|gb|ADD62888.1| photosystem II protein I
(chloroplast) [Oryza meridionalis]
gi|290790698|gb|ADD62956.1| photosystem II protein I
(chloroplast) [Oryza australiensis]
gi|290790767|gb|ADD63024.1| photosystem II protein I
(chloroplast) [Potamophila parviflora]
gi|290790835|gb|ADD63091.1| photosystem II protein I
(chloroplast) [Microlaena stipoides]
gi|336326823|gb|AEI53001.1| photosystem II protein I
(chloroplast) [Oryza meridionalis]
gi|336326899|gb|AEI53076.1| photosystem II protein I
(chloroplast) [Oryza rufipogon]
gi|336326977|gb|AEI53153.1| photosystem II protein I
(chloroplast) [Oryza rufipogon]
gi|346228288|gb|AEO21162.1| photosystem II protein I
[Leersia tisserantii] gi|346228456|gb|AEO21328.1|
photosystem II protein I [Rhynchoryza subulata]
gi|353685039|gb|AER12804.1| photosystem II protein I
(chloroplast) [Oryza sativa Indica Group]
gi|353685129|gb|AER12893.1| photosystem II protein I
(chloroplast) [Oryza sativa Indica Group]
gi|552954458|gb|AGY48926.1| photosystem II protein I
(chloroplast) [Oryza rufipogon]
gi|555945972|gb|AGZ19198.1| photosystem II protein I
(chloroplast) [Oryza rufipogon]
gi|634743444|gb|AHZ60695.1| photosystem II protein I
[Oryza glaberrima] gi|662117273|gb|AIE44559.1|
photosystem II protein I (chloroplast) [Oryza
australiensis] gi|684184581|gb|AIM53768.1| photosystem
II protein I [Zizania aquatica]
gi|761231211|gb|AJP33620.1| photosystem II protein I
(chloroplast) [Oryza barthii]
gi|761231294|gb|AJP33702.1| photosystem II protein I
(chloroplast) [Oryza barthii]
gi|761231377|gb|AJP33784.1| photosystem II protein I
(chloroplast) [Oryza barthii]
gi|761231460|gb|AJP33866.1| photosystem II protein I
(chloroplast) [Oryza barthii]
gi|761231544|gb|AJP33949.1| photosystem II protein I
(chloroplast) [Oryza glaberrima]
gi|761231626|gb|AJP34030.1| photosystem II protein I
(chloroplast) [Oryza glaberrima]
gi|761231709|gb|AJP34112.1| photosystem II protein I
(chloroplast) [Oryza glumipatula]
gi|761231793|gb|AJP34195.1| photosystem II protein I
(chloroplast) [Oryza longistaminata]
gi|761231877|gb|AJP34278.1| photosystem II protein I
(chloroplast) [Oryza longistaminata]
gi|761231961|gb|AJP34361.1| photosystem II protein I
(chloroplast) [Oryza officinalis]
gi|821607392|gb|AKH49618.1| photosystem II protein I
(chloroplast) [Chikusichloa aquatica]
gi|226680|prf||1603356E photosystem II I protein [Oryza
sativa]
Length = 36
Score = 62.0 bits (149), Expect = 1e-07
Identities = 28/28 (100%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGRDE
Sbjct: 9 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 36
>dbj|BAF42779.2| photosystem II protein I [Brassica oleracea var. capitata x
Raphanus sativus]
Length = 46
Score = 61.6 bits (148), Expect = 2e-07
Identities = 29/35 (82%), Positives = 31/35 (88%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE*KNQGFF 338
YTVVIFFVSLFIFGFLSNDPGRNPGR+E K F+
Sbjct: 9 YTVVIFFVSLFIFGFLSNDPGRNPGREELKTFLFY 43
>ref|NP_051043.1| photosystem II protein I [Arabidopsis thaliana]
gi|11467175|ref|NP_043008.1| photosystem II protein I
[Zea mays] gi|11497508|ref|NP_054916.1| photosystem II
protein I [Spinacia oleracea]
gi|13518337|ref|NP_084696.1| photosystem II protein I
[Oenothera elata subsp. hookeri]
gi|13518444|ref|NP_084804.1| photosystem II protein I
[Lotus japonicus] gi|14017556|ref|NP_114243.1|
photosystem II protein I (chloroplast) [Triticum
aestivum] gi|28261701|ref|NP_783216.1| photosystem II
protein I [Atropa belladonna]
gi|32480827|ref|NP_862738.1| photosystem II protein I
[Calycanthus floridus var. glaucus]
gi|48478758|ref|YP_024366.1| photosystem II protein I
[Saccharum hybrid cultivar SP-80-3280]
gi|50346766|ref|YP_053139.1| photosystem II protein I
[Nymphaea alba] gi|50812509|ref|YP_054612.1| photosystem
II protein I [Saccharum hybrid cultivar NCo 310]
gi|52220794|ref|YP_086950.1| photosystem II protein I
[Panax ginseng] gi|68164787|ref|YP_247583.1| photosystem
II protein I [Cucumis sativus]
gi|75755643|ref|YP_319749.1| photosystem II protein I
[Acorus calamus] gi|78102514|ref|YP_358655.1|
photosystem II protein I [Nicotiana sylvestris]
gi|78103237|ref|YP_358560.1| photosystem II protein I
[Phalaenopsis aphrodite subsp. formosana]
gi|81176234|ref|YP_398313.1| photosystem II protein I
[Lactuca sativa] gi|81301545|ref|YP_398842.1|
photosystem II protein I [Nicotiana tomentosiformis]
gi|91208886|ref|YP_538919.1| photosystem II protein I
[Gossypium hirsutum] gi|91208972|ref|YP_538832.1|
photosystem II protein I [Solanum bulbocastanum]
gi|91214149|ref|YP_538771.1| photosystem II protein I
[Glycine max] gi|91983976|ref|YP_567060.1| photosystem
II protein I (chloroplast) [Vitis vinifera]
gi|94502475|ref|YP_588101.1| photosystem II protein I
(chloroplast) [Helianthus annuus]
gi|108773114|ref|YP_635623.1| photosystem II protein I
[Solanum tuberosum] gi|108802627|ref|YP_636283.1|
photosystem II protein I (chloroplast) [Eucalyptus
globulus subsp. globulus] gi|110227063|ref|YP_665542.1|
photosystem II protein I [Populus alba]
gi|114107117|ref|YP_740101.1| photosystem II protein I
[Daucus carota] gi|114329640|ref|YP_740459.1|
photosystem II protein I [Citrus sinensis]
gi|114329730|ref|YP_740549.1| photosystem II protein I
[Platanus occidentalis] gi|114329952|ref|YP_740634.1|
photosystem II protein I [Nandina domestica]
gi|114804249|ref|YP_762245.1| PSII I protein [Morus
indica] gi|115531898|ref|YP_784054.1| photosystem II
protein I [Pelargonium x hortorum]
gi|115604918|ref|YP_784370.1| photosystem II protein I
[Drimys granadensis] gi|116617092|ref|YP_817466.1|
photosystem II protein I [Coffea arabica]
gi|118430286|ref|YP_874720.1| photosystem II protein I
(chloroplast) [Agrostis stolonifera]
gi|118430372|ref|YP_874637.1| photosystem II protein I
(chloroplast) [Hordeum vulgare subsp. vulgare]
gi|118614476|ref|YP_899391.1| photosystem II protein I
[Sorghum bicolor] gi|119368483|ref|YP_913171.1| PSII
I-protein [Gossypium barbadense]
gi|121720597|ref|YP_001001518.1| photosystem II protein
I [Nuphar advena] gi|124113271|ref|YP_001004170.2|
photosystem II protein I [Ranunculus macranthus]
gi|134093181|ref|YP_001109483.1| photosystem II protein
I [Populus trichocarpa] gi|139387236|ref|YP_001123357.1|
photosystem II protein I [Capsella bursa-pastoris]
gi|139387460|ref|YP_001122814.1| photosystem II protein
I [Phaseolus vulgaris] gi|139388078|ref|YP_001123270.1|
PSII I protein [Barbarea verna]
gi|139389080|ref|YP_001123798.1| photosystem II protein
I [Nasturtium officinale]
gi|139389248|ref|YP_001123014.1| PSII I protein
[Aethionema grandiflorum]
gi|139389402|ref|YP_001123099.1| photosystem II protein
I [Olimarabidopsis pumila]
gi|139389626|ref|YP_001123183.1| PSII I protein [Arabis
hirsuta] gi|139389785|ref|YP_001123446.1| photosystem II
protein I [Crucihimalaya wallichii]
gi|139389934|ref|YP_001123534.1| PSII I protein [Draba
nemorosa] gi|139390136|ref|YP_001123709.1| photosystem
II protein I [Lobularia maritima]
gi|139390332|ref|YP_001122930.1| PSII I protein
[Aethionema cordifolium]
gi|149390252|ref|YP_001294082.1| photosystem II protein
I [Chloranthus spicatus]
gi|149390338|ref|YP_001294336.1| photosystem II protein
I [Dioscorea elephantipes]
gi|149390524|ref|YP_001294168.1| photosystem II protein
I [Buxus microphylla] gi|157325514|ref|YP_001468292.1|
photosystem II protein I [Ipomoea purpurea]
gi|159106848|ref|YP_001531267.1| psbI gene product
(chloroplast) [Lolium perenne]
gi|159161144|ref|YP_001542431.1| photosystem II protein
I [Ceratophyllum demersum]
gi|161622294|ref|YP_001586166.1| photosystem II protein
I [Acorus americanus] gi|161784176|ref|YP_001595492.1|
PSII I protein [Lemna minor]
gi|167391789|ref|YP_001671667.1| photosystem II protein
I [Carica papaya] gi|169142717|ref|YP_001687144.1|
photosystem II protein I (chloroplast) [Oenothera
argillicola] gi|169142867|ref|YP_001687290.1|
photosystem II protein I (chloroplast) [Oenothera
glazioviana] gi|169142952|ref|YP_001687374.1|
photosystem II protein I (chloroplast) [Oenothera
biennis] gi|169143038|ref|YP_001687458.1| photosystem II
protein I (chloroplast) [Oenothera parviflora]
gi|169794057|ref|YP_001718421.1| photosystem II protein
I [Manihot esculenta] gi|183217725|ref|YP_001837344.1|
photosystem II protein I [Guizotia abyssinica]
gi|189162255|ref|YP_001936501.1| photosystem II protein
I [Fagopyrum esculentum subsp. ancestrale]
gi|194033134|ref|YP_002000472.1| photosystem II protein
I (chloroplast) [Brachypodium distachyon]
gi|218176229|ref|YP_002364486.1| photosystem II protein
I (chloroplast) [Festuca arundinacea]
gi|225544108|ref|YP_002720096.1| psbI [Jatropha curcas]
gi|229577738|ref|YP_002836074.1| photosystem II protein
I [Megaleranthis saniculifolia]
gi|253729541|ref|YP_003029724.1| Psbl (chloroplast)
[Bambusa oldhamii] gi|255961367|ref|YP_003097560.1|
photosystem II protein I (chloroplast) [Dendrocalamus
latiflorus] gi|260677378|ref|YP_003208172.1| photosystem
II protein I [Coix lacryma-jobi]
gi|281190768|ref|YP_003330951.1| photosystem II protein
I [Parthenium argentatum]
gi|283794952|ref|YP_003359343.1| PSII I protein
(chloroplast) [Olea europaea]
gi|289065073|ref|YP_003433959.1| photosystem II protein
I [Typha latifolia] gi|289066834|ref|YP_003434352.1|
photosystem II protein I [Vigna radiata]
gi|295065712|ref|YP_003587652.1| photosystem II protein
I [Anomochloa marantoidea]
gi|295311716|ref|YP_003587452.1| photosystem II protein
I [Oncidium hybrid cultivar]
gi|300388132|ref|YP_003778187.1| photosystem II protein
I [Phoenix dactylifera] gi|309322118|ref|YP_003933934.1|
photosystem II protein I [Erodium texanum]
gi|309322435|ref|YP_003933948.1| photosystem II protein
I [Eucalyptus grandis] gi|313183806|ref|YP_004021649.1|
photosystem II protein I [Prunus persica]
gi|313199687|ref|YP_004021301.1| photosystem II protein
I [Theobroma cacao] gi|317046157|ref|YP_004072446.1|
PSII I protein [Corynocarpus laevigata]
gi|323148814|ref|YP_004221907.1| photosystem II protein
I [Erodium carvifolium] gi|323149066|ref|YP_004222630.1|
photosystem II protein I (chloroplast) [Anthriscus
cerefolium] gi|325210914|ref|YP_004285988.1| photosystem
II protein I [Gossypium thurberi]
gi|326909377|ref|YP_004327646.1| photosystem II protein
I [Hevea brasiliensis] gi|330850727|ref|YP_004376405.1|
photosystem II protein I [Olea europaea subsp. europaea]
gi|334361933|ref|YP_004563851.1| photosystem II protein
I [Nelumbo lutea] gi|334700266|ref|YP_004563765.1|
photosystem II protein I [Olea europaea subsp.
cuspidata] gi|334701603|ref|YP_004563988.1| photosystem
II protein I [Olea woodiana subsp. woodiana]
gi|334701786|ref|YP_004564356.1| photosystem II protein
I (chloroplast) [Ageratina adenophora]
gi|334701872|ref|YP_004564481.1| photosystem II protein
I [Olea europaea subsp. maroccana]
gi|334702309|ref|YP_004465172.1| photosystem II protein
I [Jacobaea vulgaris] gi|339906437|ref|YP_004733229.1|
photosystem II protein I [Indocalamus longiauritus]
gi|340034011|ref|YP_004733563.1| photosystem II protein
I (chloroplast) [Phyllostachys edulis]
gi|340034182|ref|YP_004733745.1| photosystem II protein
I (chloroplast) [Acidosasa purpurea]
gi|340034350|ref|YP_004733963.1| photosystem II protein
I (chloroplast) [Phyllostachys nigra var. henonis]
gi|340034435|ref|YP_004734086.1| photosystem II protein
I (chloroplast) [Bambusa emeiensis]
gi|340034521|ref|YP_004734170.1| photosystem II protein
I [Ferrocalamus rimosivaginus]
gi|342316105|ref|YP_004769614.1| photosystem II protein
I (chloroplast) [Spirodela polyrhiza]
gi|342316274|ref|YP_004769796.1| photosystem II protein
I (chloroplast) [Wolffiella lingulata]
gi|342316358|ref|YP_004769931.1| photosystem II protein
I (chloroplast) [Wolffia australiana]
gi|345895201|ref|YP_004841933.1| photosystem II protein
I [Panicum virgatum] gi|346578175|ref|YP_004841767.1|
photosystem II protein I [Cucumis melo subsp. melo]
gi|346683278|ref|YP_004842223.1| photosystem IIprotein I
[Pyrus pyrifolia] gi|351653858|ref|YP_004891583.1| psbI
gene product (chloroplast) [Nicotiana undulata]
gi|359422127|ref|YP_004935536.1| photosystem II protein
I (chloroplast) [Eleutherococcus senticosus]
gi|359422245|ref|YP_004935650.1| psbI gene product
(chloroplast) [Sesamum indicum]
gi|372290918|ref|YP_005087677.1| photosystem II protein
I (chloroplast) [Gossypium raimondii]
gi|372291017|ref|YP_005087773.1| photosystem II protein
I (chloroplast) [Gossypium darwinii]
gi|372291370|ref|YP_005088264.1| photosystem II protein
I (chloroplast) [Gossypium tomentosum]
gi|372291468|ref|YP_005088360.1| photosystem II protein
I (chloroplast) [Gossypium herbaceum subsp. africanum]
gi|372291758|ref|YP_005088900.1| photosystem II protein
I (chloroplast) [Gossypium mustelinum]
gi|372291842|ref|YP_005088983.1| photosystem II protein
I (chloroplast) [Gossypium arboreum]
gi|372450123|ref|YP_005090162.1| psbI gene product
(chloroplast) [Ricinus communis]
gi|374249335|ref|YP_005088517.1| psbI gene product
(chloroplast) [Phyllostachys propinqua]
gi|374249547|ref|YP_005088817.1| photosystem II protein
I (chloroplast) [Millettia pinnata]
gi|377819362|ref|YP_005097858.1| photosystem II protein
I (chloroplast) [Colocasia esculenta]
gi|377829860|ref|YP_005296084.1| psbI gene product
(chloroplast) [Pentactina rupicola]
gi|383930430|ref|YP_005089936.1| psbI gene product
(chloroplast) [Brassica napus]
gi|385153478|ref|YP_006073252.1| photosystem II protein
I (chloroplast) [Phalaenopsis equestris]
gi|386800823|ref|YP_006303475.1| photosystem II protein
I (chloroplast) [Gossypium gossypioides]
gi|393396112|ref|YP_006460351.1| photosystem II protein
I (chloroplast) [Vigna unguiculata]
gi|394830612|ref|YP_006503261.1| photosystem II protein
I (chloroplast) [Gossypium incanum]
gi|394830699|ref|YP_006503344.1| photosystem II protein
I (chloroplast) [Gossypium somalense]
gi|394830785|ref|YP_006503427.1| photosystem II protein
I (chloroplast) [Gossypium capitis-viridis]
gi|394830874|ref|YP_006503510.1| photosystem II protein
I (chloroplast) [Gossypium areysianum]
gi|394830961|ref|YP_006503593.1| photosystem II protein
I (chloroplast) [Gossypium robinsonii]
gi|394831086|ref|YP_006503775.1| photosystem II protein
I (chloroplast) [Datura stramonium]
gi|395001659|ref|YP_006503676.1| photosystem II protein
I (chloroplast) [Erycina pusilla]
gi|404474395|ref|YP_006665764.1| photosystem II protein
I (chloroplast) [Elodea canadensis]
gi|404474509|ref|YP_006666014.1| photosystem II protein
I (chloroplast) [Capsicum annuum]
gi|426406623|ref|YP_007026537.1| photosystem II protein
I [Festuca ovina] gi|427436959|ref|YP_007026451.1|
photosystem II protein I [Festuca altissima]
gi|427437056|ref|YP_007026623.1| photosystem II protein
I [Festuca pratensis] gi|427437202|ref|YP_007026709.1|
photosystem II protein I [Lolium multiflorum]
gi|435856357|ref|YP_007317232.1| photosystem II protein
I (chloroplast) [Camellia sinensis]
gi|441403276|ref|YP_007353750.1| photosystem II protein
I (chloroplast) [Chrysanthemum x morifolium]
gi|442742947|ref|YP_007353899.1| photosystem II protein
I (chloroplast) [Tectona grandis]
gi|452849035|ref|YP_007474713.1| photosystem II protein
I (chloroplast) [Chrysanthemum indicum]
gi|452849467|ref|YP_007475124.1| photosystem II protein
I (chloroplast) [Arundinaria gigantea]
gi|456061435|ref|YP_007475603.1| photosystem II protein
I [Heliconia collinsiana]
gi|456061870|ref|YP_007476031.1| photosystem II protein
I [Dasypogon bromeliifolius]
gi|459014477|ref|YP_007507095.1| photosystem II protein
I (chloroplast) [Salvia miltiorrhiza]
gi|470227692|ref|YP_007624779.1| photosystem II protein
psbI protein (chloroplast) [Artemisia frigida]
gi|482651183|ref|YP_007890357.1| photosystem II protein
I (chloroplast) [Ardisia polysticta]
gi|501594940|ref|YP_007889732.1| photosystem II protein
I (chloroplast) [Vigna angularis]
gi|501770838|ref|YP_007889845.1| photosystem II protein
I [Francoa sonchifolia] gi|511348320|ref|YP_008081249.1|
photosystem II protein I (chloroplast) (chloroplast)
[Catharanthus roseus] gi|511348422|ref|YP_008081349.1|
photosystem II protein I (chloroplast) [Tetracentron
sinense] gi|511348515|ref|YP_008081441.1| photosystem II
protein I (chloroplast) [Trochodendron aralioides]
gi|511943406|ref|YP_008081636.1| photosystem II protein
I (chloroplast) [Cymbidium sinense]
gi|511943620|ref|YP_008081870.1| photosystem II protein
I (chloroplast) [Cymbidium mannii]
gi|512721467|ref|YP_008081714.1| photosystem II protein
I (chloroplast) [Cymbidium tortisepalum]
gi|519704488|ref|YP_008082565.1| photosystem II protein
I (chloroplast) [Utricularia gibba]
gi|520850556|ref|YP_008081558.1| photosystem II protein
I (chloroplast) [Cymbidium aloifolium]
gi|520850590|ref|YP_008145350.1| photosystem II protein
I (chloroplast) [Glycine tomentella]
gi|525778489|ref|YP_008239077.1| photosystem II protein
I (chloroplast) [Triticum monococcum]
gi|525782200|ref|YP_008239156.1| photosystem II protein
I (chloroplast) [Secale cereale]
gi|525782279|ref|YP_008239233.1| photosystem II protein
I (chloroplast) [Triticum urartu]
gi|526175899|ref|YP_008145717.1| photosystem II protein
I (chloroplast) [Glycine cyrtoloba]
gi|526175986|ref|YP_008145798.1| photosystem II protein
I (chloroplast) [Glycine stenophita]
gi|526176070|ref|YP_008145880.1| photosystem II protein
I (chloroplast) [Glycine canescens]
gi|526176157|ref|YP_008145962.1| photosystem II protein
I (chloroplast) [Glycine dolichocarpa]
gi|526176244|ref|YP_008146044.1| photosystem II protein
I (chloroplast) [Glycine falcata]
gi|526176338|ref|YP_008146126.1| photosystem II protein
I (chloroplast) [Glycine syndetika]
gi|533310089|ref|YP_008474284.1| photosystem II protein
I (chloroplast) [Aegilops tauschii]
gi|533310185|ref|YP_008474375.1| photosystem II protein
I (chloroplast) [Aegilops speltoides]
gi|544163597|ref|YP_008563072.1| photosystem II protein
I (chloroplast) [Solanum lycopersicum]
gi|545716229|ref|YP_008575097.1| photosystem II protein
I (chloroplast) [Eucalyptus obliqua]
gi|545716315|ref|YP_008575182.1| photosystem II protein
I (chloroplast) [Eucalyptus radiata]
gi|545716401|ref|YP_008575267.1| photosystem II protein
I (chloroplast) [Eucalyptus delegatensis]
gi|545716487|ref|YP_008575352.1| photosystem II protein
I (chloroplast) [Eucalyptus verrucata]
gi|545716573|ref|YP_008575437.1| photosystem II protein
I (chloroplast) [Eucalyptus baxteri]
gi|545716659|ref|YP_008575522.1| photosystem II protein
I (chloroplast) [Eucalyptus diversifolia]
gi|545716745|ref|YP_008575607.1| photosystem II protein
I (chloroplast) [Eucalyptus sieberi]
gi|545716831|ref|YP_008575692.1| photosystem II protein
I (chloroplast) [Eucalyptus elata]
gi|545716917|ref|YP_008575777.1| photosystem II protein
I (chloroplast) [Eucalyptus regnans]
gi|545717003|ref|YP_008575862.1| photosystem II protein
I (chloroplast) [Eucalyptus umbra]
gi|545717089|ref|YP_008575947.1| photosystem II protein
I (chloroplast) [Eucalyptus cloeziana]
gi|545717175|ref|YP_008576032.1| photosystem II protein
I (chloroplast) [Eucalyptus patens]
gi|545717261|ref|YP_008576117.1| photosystem II protein
I (chloroplast) [Eucalyptus marginata]
gi|545717347|ref|YP_008576202.1| photosystem II protein
I (chloroplast) [Eucalyptus curtisii]
gi|545717433|ref|YP_008576287.1| photosystem II protein
I (chloroplast) [Eucalyptus melliodora]
gi|545717519|ref|YP_008576372.1| photosystem II protein
I (chloroplast) [Eucalyptus polybractea]
gi|545717605|ref|YP_008576457.1| photosystem II protein
I (chloroplast) [Eucalyptus cladocalyx]
gi|545717691|ref|YP_008576542.1| photosystem II protein
I (chloroplast) [Eucalyptus nitens]
gi|545717777|ref|YP_008576627.1| photosystem II protein
I (chloroplast) [Eucalyptus aromaphloia]
gi|545717863|ref|YP_008576712.1| photosystem II protein
I (chloroplast) [Eucalyptus saligna]
gi|545717949|ref|YP_008576797.1| photosystem II protein
I (chloroplast) [Eucalyptus camaldulensis]
gi|545718035|ref|YP_008576882.1| photosystem II protein
I (chloroplast) [Eucalyptus deglupta]
gi|545718121|ref|YP_008576967.1| photosystem II protein
I (chloroplast) [Eucalyptus spathulata]
gi|545718207|ref|YP_008577052.1| photosystem II protein
I (chloroplast) [Eucalyptus torquata]
gi|545718293|ref|YP_008577137.1| photosystem II protein
I (chloroplast) [Eucalyptus diversicolor]
gi|545718379|ref|YP_008577222.1| photosystem II protein
I (chloroplast) [Eucalyptus salmonophloia]
gi|545718465|ref|YP_008577307.1| photosystem II protein
I (chloroplast) [Eucalyptus microcorys]
gi|545718551|ref|YP_008577392.1| photosystem II protein
I (chloroplast) [Eucalyptus guilfoylei]
gi|545718637|ref|YP_008577477.1| photosystem II protein
I (chloroplast) [Eucalyptus erythrocorys]
gi|545718723|ref|YP_008577562.1| photosystem II protein
I (chloroplast) [Corymbia gummifera]
gi|545718809|ref|YP_008577647.1| photosystem II protein
I (chloroplast) [Corymbia maculata]
gi|545718895|ref|YP_008577732.1| photosystem II protein
I (chloroplast) [Corymbia eximia]
gi|545718981|ref|YP_008577817.1| photosystem II protein
I (chloroplast) [Corymbia tessellaris]
gi|545719067|ref|YP_008577902.1| photosystem II protein
I (chloroplast) [Angophora floribunda]
gi|545719153|ref|YP_008577987.1| photosystem II protein
I (chloroplast) [Angophora costata]
gi|545719239|ref|YP_008578157.1| photosystem II protein
I (chloroplast) [Stockwellia quadrifida]
gi|545719400|ref|YP_008578523.1| photosystem II protein
I (chloroplast) (chloroplast) [Asclepias nivea]
gi|545719411|ref|YP_008578072.1| photosystem II protein
I (chloroplast) [Allosyncarpia ternata]
gi|545907176|ref|YP_008578608.1| photosystem II protein
I (chloroplast) (chloroplast) [Asclepias syriaca]
gi|552541287|ref|YP_008592472.1| photosystem II protein
I (chloroplast) [Andrographis paniculata]
gi|552546073|ref|YP_008592623.1| photosystem II protein
I (chloroplast) [Berberis bealei]
gi|556927216|ref|YP_008758172.1| photosystem II protein
I (chloroplast) [Veratrum patulum]
gi|558602896|ref|YP_008814927.1| photosystem II protein
I (chloroplast) [Brassaiopsis hainla]
gi|558602984|ref|YP_008815014.1| photosystem II protein
I (chloroplast) [Metapanax delavayi]
gi|558603072|ref|YP_008815101.1| photosystem II protein
I (chloroplast) [Schefflera delavayi]
gi|558604143|ref|YP_008816253.1| photosystem II protein
I (chloroplast) [Glycine soja]
gi|563354764|ref|YP_008855075.1| photosystem II protein
I (chloroplast) [Phragmites australis]
gi|563940263|ref|YP_008814840.1| photosystem II protein
I (chloroplast) [Aralia undulata]
gi|563940369|ref|YP_008815188.1| photosystem II protein
I (chloroplast) [Kalopanax septemlobus]
gi|563940536|ref|YP_008854409.1| photosystem II protein
I [Musa textilis] gi|563940639|ref|YP_008854495.1|
photosystem II protein I [Ravenala madagascariensis]
gi|568244543|ref|YP_008963290.1| photosystem II protein
I [Camellia oleifera] gi|568244631|ref|YP_008963378.1|
photosystem II protein I (chloroplast) [Sedum
sarmentosum] gi|568244718|ref|YP_008963464.1|
photosystem II protein I (chloroplast) [Penthorum
chinense] gi|568244823|ref|YP_008963607.1| photosystem
II protein I (chloroplast) [Lupinus luteus]
gi|568244894|ref|YP_008963675.1| photosystem II protein
I (chloroplast) [Liquidambar formosana]
gi|568244980|ref|YP_008963888.1| photosystem II protein
I (chloroplast) [Aegilops geniculata]
gi|568245191|ref|YP_008964341.1| photosystem II protein
I [Helianthus divaricatus]
gi|568245277|ref|YP_008964426.1| photosystem II protein
I [Helianthus decapetalus]
gi|568245363|ref|YP_008964681.1| photosystem II protein
I [Helianthus strumosus]
gi|568245449|ref|YP_008964766.1| photosystem II protein
I [Helianthus maximiliani]
gi|568246715|ref|YP_008965477.1| photosystem II protein
I [Pyrus spinosa] gi|568246978|ref|YP_008963811.1|
photosystem II protein I (chloroplast) [Aegilops
cylindrica] gi|568247093|ref|YP_008964018.1| photosystem
II protein I [Ajuga reptans]
gi|568247141|ref|YP_008964171.1| photosystem II protein
I [Helianthus giganteus]
gi|568247227|ref|YP_008964256.1| photosystem II protein
I [Helianthus grosseserratus]
gi|568247313|ref|YP_008964511.1| photosystem II protein
I [Helianthus hirsutus] gi|568247399|ref|YP_008964596.1|
photosystem II protein I [Helianthus tuberosus]
gi|570700396|ref|YP_008994057.1| photosystem II protein
I (chloroplast) [Fritillaria taipaiensis]
gi|570758865|ref|YP_008992448.1| photosystem II protein
I (chloroplast) [Gossypium anomalum]
gi|570758952|ref|YP_008992534.1| photosystem II protein
I (chloroplast) [Gossypium bickii]
gi|570759040|ref|YP_008992879.1| photosystem II protein
I (chloroplast) [Gossypium sturtianum]
gi|570759560|ref|YP_008992621.1| photosystem II protein
I (chloroplast) [Gossypium herbaceum]
gi|570759647|ref|YP_008992707.1| photosystem II protein
I (chloroplast) [Gossypium longicalyx]
gi|570879898|ref|YP_008992793.1| photosystem II protein
I (chloroplast) [Gossypium stocksii]
gi|570880001|ref|YP_008994274.1| photosystem II protein
I [Melianthus villosus] gi|570880220|ref|YP_008994494.1|
photosystem II protein I (chloroplast) (chloroplast)
[Hypseocharis bilobata] gi|570880295|ref|YP_008994552.1|
photosystem II protein I (chloroplast) (chloroplast)
[Pelargonium alternans] gi|575770990|ref|YP_009000316.1|
psbI protein (chloroplast) [Arabis alpina]
gi|586929216|ref|YP_009001977.1| photosystem II protein
I (chloroplast) [Puelia olyriformis]
gi|589229806|ref|YP_009003813.1| photosystem II protein
I [Deschampsia antarctica]
gi|590000400|ref|YP_009004029.1| photosystem II protein
I [Cucumis hystrix] gi|595789579|ref|YP_009019775.1|
photosystem II protein I (chloroplast) [Vitis
rotundifolia] gi|595789664|ref|YP_009019872.1|
photosystem II protein I (chloroplast) [Azadirachta
indica] gi|595789751|ref|YP_009020022.1| photosystem II
protein I [Prunus mume] gi|608787542|ref|YP_009024239.1|
photosystem II protein I (chloroplast) [Arundinaria
appalachiana] gi|608787626|ref|YP_009024322.1|
photosystem II protein I (chloroplast) [Arundinaria
tecta] gi|618750291|ref|YP_009026424.1| photosystem II
protein I (chloroplast) [Dendrobium catenatum]
gi|628249148|ref|YP_009024665.1| photosystem II protein
I (chloroplast) [Prunus kansuensis]
gi|630716106|ref|YP_009027871.1| photosystem II protein
I (chloroplast) (chloroplast) [Hirtella racemosa]
gi|630716204|ref|YP_009027954.1| photosystem II protein
I (chloroplast) (chloroplast) [Chrysobalanus icaco]
gi|630716303|ref|YP_009028037.1| photosystem II protein
I (chloroplast) (chloroplast) [Licania heteromorpha]
gi|630716396|ref|YP_009028203.1| photosystem II protein
I (chloroplast) (chloroplast) [Licania alba]
gi|630716495|ref|YP_009028286.1| photosystem II protein
I (chloroplast) (chloroplast) [Licania sprucei]
gi|642276430|ref|YP_009033428.1| photosystem II protein
I [Olyra latifolia] gi|649132348|ref|YP_009033954.1|
photosystem II protein I (plastid) [Cenchrus americanus]
gi|651249253|ref|YP_009033869.1| photosystem II protein
I (plastid) [Dioscorea rotundata]
gi|651424225|ref|YP_009040390.1| photosystem II protein
I (chloroplast) (chloroplast) [Neyraudia reynaudiana]
gi|651514774|ref|YP_009040784.1| photosystem II protein
I (chloroplast) (chloroplast) [Centaurea diffusa]
gi|657302680|ref|YP_009040302.1| photosystem II protein
I [Hyoscyamus niger] gi|662015785|ref|YP_009028369.1|
photosystem II protein I (chloroplast) [Hirtella
physophora] gi|662020572|ref|YP_009028120.1| photosystem
II protein I (chloroplast) [Couepia guianensis]
gi|662020656|ref|YP_009028452.1| photosystem II protein
I (chloroplast) [Parinari campestris]
gi|662020666|ref|YP_009029854.1| photosystem II protein
I (chloroplast) [Lecomtella madagascariensis]
gi|663060358|ref|YP_009046898.1| photosystem II protein
I (chloroplast) [Raphanus sativus]
gi|669100150|ref|YP_009048005.1| photosystem II protein
I (chloroplast) [Nymphaea mexicana]
gi|669100422|ref|YP_009048271.1| photosystem II protein
I (chloroplast) [Magnolia yunnanensis]
gi|669100435|ref|YP_009048559.1| photosystem II protein
I [Paris verticillata] gi|671741914|ref|YP_009050572.1|
photosystem II protein I (chloroplast) [Camellia
grandibracteata] gi|671742002|ref|YP_009050659.1|
photosystem II protein I (chloroplast) [Camellia
leptophylla] gi|671743055|ref|YP_009050107.1|
photosystem II protein I [Erodium trifolium]
gi|671743215|ref|YP_009050746.1| photosystem II protein
I (chloroplast) [Camellia petelotii]
gi|671743303|ref|YP_009050833.1| photosystem II protein
I (chloroplast) [Camellia pubicosta]
gi|671743391|ref|YP_009050920.1| photosystem II protein
I (chloroplast) [Camellia reticulata]
gi|671743683|ref|YP_009051235.1| photosystem II protein
I (chloroplast) [Bambusa multiplex]
gi|671743769|ref|YP_009051320.1| photosystem II protein
I (chloroplast) [Phyllostachys sulphurea]
gi|671743854|ref|YP_009051546.1| photosystem II 48-kDa
truncated I protein (chloroplast) [Salix interior]
gi|674840351|ref|YP_009054203.1| photosystem II protein
I (chloroplast) [Fritillaria hupehensis]
gi|675154047|ref|YP_009052569.1| photosystem II protein
I (chloroplast) [Arundinaria fargesii]
gi|675154131|ref|YP_009052652.1| photosystem II protein
I (chloroplast) [Sarocalamus faberi]
gi|675154216|ref|YP_009052736.1| photosystem II protein
I (chloroplast) [Chimonocalamus longiusculus]
gi|675154299|ref|YP_009052818.1| photosystem II protein
I (chloroplast) [Fargesia nitida]
gi|675154383|ref|YP_009052901.1| photosystem II protein
I (chloroplast) [Fargesia spathacea]
gi|675154467|ref|YP_009052984.1| photosystem II protein
I (chloroplast) [Fargesia yunnanensis]
gi|675154551|ref|YP_009053067.1| photosystem II protein
I (chloroplast) [Gaoligongshania megalothyrsa]
gi|675154635|ref|YP_009053150.1| photosystem II protein
I (chloroplast) [Gelidocalamus tessellatus]
gi|675154719|ref|YP_009053233.1| photosystem II protein
I (chloroplast) [Indocalamus wilsonii]
gi|675154803|ref|YP_009053316.1| photosystem II protein
I (chloroplast) [Indosasa sinica]
gi|675154886|ref|YP_009053398.1| photosystem II protein
I (chloroplast) [Oligostachyum shiuyingianum]
gi|675154969|ref|YP_009053645.1| photosystem II protein
I (chloroplast) [Yushania levigata]
gi|675155054|ref|YP_009053754.1| photosystem II protein
I (chloroplast) [Fritillaria cirrhosa]
gi|675155137|ref|YP_009054120.1| photosystem II 48-kDa
truncated I protein (chloroplast) [Populus balsamifera]
gi|675155219|ref|YP_009054413.1| photosystem II protein
I (chloroplast) [Populus euphratica]
gi|675155305|ref|YP_009053480.1| photosystem II protein
I (chloroplast) [Pleioblastus maculatus]
gi|675155410|ref|YP_009053562.1| photosystem II protein
I (chloroplast) [Thamnocalamus spathiflorus]
gi|675155494|ref|YP_009053864.1| photosystem II protein
I (plastid) [Ampelocalamus calcareus]
gi|675277966|ref|YP_009054039.1| photosystem II 48-kDa
truncated I protein (chloroplast) [Populus fremontii]
gi|694136664|ref|YP_009072573.1| photosystem II protein
I [Aristida purpurea] gi|694136750|ref|YP_009072658.1|
photosystem II protein I [Centotheca lappacea]
gi|694136836|ref|YP_009072743.1| photosystem II protein
I [Chionochloa macra] gi|694136922|ref|YP_009072828.1|
photosystem II protein I [Coleataenia prionitis]
gi|694137008|ref|YP_009072913.1| photosystem II protein
I [Danthonia californica]
gi|694137094|ref|YP_009072998.1| photosystem II protein
I [Elytrophorus spicatus]
gi|694137178|ref|YP_009073081.1| photosystem II protein
I [Eriachne stipacea] gi|694137262|ref|YP_009073164.1|
photosystem II protein I [Hakonechloa macra]
gi|694137344|ref|YP_009073245.1| photosystem II protein
I [Isachne distichophylla]
gi|694137428|ref|YP_009073328.1| photosystem II protein
I [Monachather paradoxus]
gi|694137512|ref|YP_009073411.1| photosystem II protein
I [Thysanolaena latifolia]
gi|697964745|ref|YP_009059333.1| photosystem II protein
I (chloroplast) [Citrus aurantiifolia]
gi|697964915|ref|YP_009059503.1| photosystem II protein
I [Iris gatesii] gi|700491214|ref|YP_009093934.1|
photosystem II protein I (chloroplast) [Nelumbo
nucifera] gi|712911581|ref|YP_009092287.1| photosystem
II protein I (chloroplast) [Macadamia integrifolia]
gi|712911682|ref|YP_009092667.1| photosystem II protein
I [Eustrephus latifolius]
gi|712911783|ref|YP_009092751.1| photosystem II protein
I [Bomarea edulis] gi|712912030|ref|YP_009093784.1|
photosystem II protein I (chloroplast) [Luzuriaga
radicans] gi|723457509|ref|YP_009107547.1| photosystem
II protein I (chloroplast) [Phalaenopsis hybrid
cultivar] gi|724137108|ref|YP_009108743.1| photosystem
II protein I [Oncinotis tenuiloba]
gi|725666000|ref|YP_009108573.1| photosystem II protein
I [Echites umbellatus] gi|728792453|ref|YP_009108828.1|
photosystem II protein I [Pentalinon luteum]
gi|731971815|ref|YP_009110586.1| photosystem II protein
I (chloroplast) [Hesperelaea palmeri]
gi|733387613|ref|YP_009111721.1| photosystem II protein
psbI protein (chloroplast) [Artemisia montana]
gi|735955191|ref|YP_009111480.1| photosystem II protein
I [Erodium crassifolium]
gi|735955279|ref|YP_009111557.1| photosystem II protein
I [Erodium gruinum] gi|735955386|ref|YP_009111662.1|
photosystem II protein I (chloroplast) [Apios americana]
gi|735955457|ref|YP_009112450.1| photosystem II protein
I (chloroplast) [Triticum macha]
gi|745998923|ref|YP_009108658.1| photosystem II protein
I [Nerium oleander] gi|746001664|ref|YP_009114219.1|
photosystem II protein psbI protein (chloroplast) [Sedum
takesimense] gi|746948286|ref|YP_009110320.1|
photosystem II protein I (chloroplast) [Morus mongolica]
gi|746948618|ref|YP_009115399.1| PsbI; photosystem II
protein I (chloroplast) [Acacia ligulata]
gi|749111692|ref|YP_009115666.1| photosystem II protein
I [Lysimachia coreana] gi|751425700|ref|YP_009116326.1|
photosystem II protein I (chloroplast) [Ananas comosus]
gi|752789668|ref|YP_009115879.1| photosystem II protein
I [Scrophularia takesimensis]
gi|752789770|ref|YP_009117205.1| photosystem II protein
I (chloroplast) [Premna microphylla]
gi|756877456|ref|YP_009117659.1| photosystem II protein
I [Acorus gramineus] gi|761379972|ref|YP_009121157.1|
photosystem II protein I (chloroplast) [Panax
notoginseng] gi|761380167|ref|YP_009121603.1|
photosystem II protein I (chloroplast) [Salix
suchowensis] gi|772311235|ref|YP_009127119.1|
photosystem II protein I (chloroplast) [Arachis
hypogaea] gi|772649668|ref|YP_009127178.1| photosystem
II protein I (chloroplast) [Libidibia coriaria]
gi|772649765|ref|YP_009127262.1| photosystem II protein
I (chloroplast) [Ceratonia siliqua]
gi|772649983|ref|YP_009127450.1| photosystem II protein
I (chloroplast) [Indigofera tinctoria]
gi|772650058|ref|YP_009128055.1| photosystem II protein
I (chloroplast) [Actinidia deliciosa]
gi|772657009|ref|YP_009127532.1| photosystem II protein
I (chloroplast) [Lupinus albus]
gi|772657121|ref|YP_009127615.1| photosystem II protein
I (chloroplast) [Pachyrhizus erosus]
gi|772657227|ref|YP_009127781.1| photosystem II protein
I (chloroplast) [Robinia pseudoacacia]
gi|772657313|ref|YP_009127839.1| photosystem II protein
I (chloroplast) [Tamarindus indica]
gi|772657540|ref|YP_009128375.1| photosystem II protein
I (chloroplast) [Ipomoea batatas]
gi|772657737|ref|YP_009128777.1| photosystem II protein
I (chloroplast) [Salix purpurea]
gi|788229109|ref|YP_009122571.1| photosystem II protein
I (chloroplast) [Masdevallia coccinea]
gi|788229288|ref|YP_009122709.1| photosystem II protein
I (chloroplast) [Dendropanax dentiger]
gi|788229397|ref|YP_009123236.1| photosystem II protein
I (chloroplast) [Chloranthus japonicus]
gi|788229660|ref|YP_009127676.1| photosystem II protein
I (chloroplast) [Prosopis glandulosa]
gi|788229766|ref|YP_009127972.1| photosystem II protein
I (chloroplast) [Actinidia chinensis]
gi|788366067|ref|YP_009123419.1| photosystem II protein
I (chloroplast) [Cattleya crispata]
gi|806636717|ref|YP_009129602.1| photosystem II protein
I (chloroplast) [Paphiopedilum niveum]
gi|806636806|ref|YP_009129676.1| photosystem II protein
I (chloroplast) [Masdevallia picturata]
gi|810852801|ref|YP_009130026.1| photosystem II protein
I (chloroplast) [Campynema lineare]
gi|810932456|ref|YP_009129328.1| photosystem II protein
I (chloroplast) [Cypripedium formosanum]
gi|810932563|ref|YP_009129415.1| photosystem II protein
I (chloroplast) [Goodyera fumata]
gi|810932670|ref|YP_009129515.1| photosystem II protein
I (chloroplast) [Habenaria pantlingiana]
gi|810932732|ref|YP_009130111.1| photosystem II protein
I (chloroplast) [Carludovica palmata]
gi|810932832|ref|YP_009130197.1| photosystem II protein
I (chloroplast) [Lilium superbum]
gi|813423486|ref|YP_009130945.1| photosystem II protein
I (chloroplast) [Lonicera japonica]
gi|813424002|ref|YP_009131697.1| photosystem II protein
I (chloroplast) [Solanum cheesmaniae]
gi|813424107|ref|YP_009131946.1| photosystem II protein
I (chloroplast) [Solanum habrochaites]
gi|813424252|ref|YP_009132029.1| photosystem II protein
I (chloroplast) [Solanum neorickii]
gi|813427772|ref|YP_009132923.1| photosystem II protein
I (chloroplast) [Hibiscus syriacus]
gi|813559144|ref|YP_009131125.1| photosystem II protein
I (chloroplast) [Erodium absinthoides]
gi|813559393|ref|YP_009131780.1| photosystem II protein
I (chloroplast) [Solanum chilense]
gi|813559477|ref|YP_009131863.1| photosystem II protein
I (chloroplast) [Solanum galapagense]
gi|813559561|ref|YP_009132112.1| photosystem II protein
I (chloroplast) [Solanum peruvianum]
gi|813559645|ref|YP_009132195.1| photosystem II protein
I (chloroplast) [Solanum pimpinellifolium]
gi|814071457|ref|YP_009120987.1| photosystem II protein
I (plastid) [Cardamine impatiens]
gi|814071543|ref|YP_009121072.1| photosystem II protein
I (plastid) [Cardamine resedifolia]
gi|814071769|ref|YP_009122848.1| photosystem II protein
I (chloroplast) [Capsicum lycianthoides]
gi|814071853|ref|YP_009123057.1| photosystem II protein
I (chloroplast) [Cannabis sativa]
gi|814072127|ref|YP_009129839.1| photosystem II protein
I (chloroplast) [Paphiopedilum armeniacum]
gi|817524692|ref|YP_009134765.1| photosystem II protein
I (plastid) [Bambusa bambos]
gi|817524777|ref|YP_009134848.1| photosystem II protein
I (plastid) [Bambusa arnhemica]
gi|817524861|ref|YP_009134931.1| photosystem II protein
I (plastid) [Chusquea spectabilis]
gi|817524948|ref|YP_009135014.1| photosystem II protein
I (plastid) [Diandrolyra sp. Clark 1301]
gi|817525129|ref|YP_009135177.1| photosystem II protein
I (plastid) [Hickelia madagascariensis]
gi|817525217|ref|YP_009135260.1| photosystem II protein
I (plastid) [Neohouzeaua sp. Clark & Attigala 1712]
gi|817525304|ref|YP_009135343.1| photosystem II protein
I (plastid) [Neololeba atra]
gi|817525395|ref|YP_009135426.1| photosystem II protein
I (plastid) [Olmeca reflexa]
gi|817525483|ref|YP_009135509.1| photosystem II protein
I (plastid) [Raddia brasiliensis]
gi|817525664|ref|YP_009135677.1| photosystem II protein
I (plastid) [Buergersiochloa bambusoides]
gi|817525752|ref|YP_009135760.1| photosystem II protein
I (plastid) [Chusquea liebmannii]
gi|817525868|ref|YP_009135842.1| photosystem II protein
I (plastid) [Lithachne pauciflora]
gi|817525989|ref|YP_009135922.1| photosystem II protein
I (plastid) [Otatea acuminata]
gi|817526133|ref|YP_009136005.1| photosystem II protein
I (plastid) [Pariana radiciflora]
gi|817527315|ref|YP_009136295.1| photosystem II protein
I (chloroplast) [Prunus yedoensis]
gi|817527553|ref|YP_009136379.1| photosystem II protein
I (chloroplast) [Prunus maximowiczii]
gi|817527791|ref|YP_009136463.1| photosystem II protein
I (chloroplast) [Prunus padus]
gi|817530133|ref|YP_009136722.1| photosystem II protein
I (plastid) [Guadua weberbaueri]
gi|821317169|ref|YP_009138261.1| photosystem II protein
I (chloroplast) [Erodium chrysanthum]
gi|821318017|ref|YP_009139085.1| photosystem II protein
I (chloroplast) [Dioscorea zingiberensis]
gi|821318114|ref|YP_009139247.1| photosystem II protein
I (chloroplast) [Populus yunnanensis]
gi|821318540|ref|YP_009139663.1| photosystem II protein
I (chloroplast) [Morus notabilis]
gi|821318652|ref|YP_009139772.1| photosystem II protein
I (chloroplast) [Cynara humilis]
gi|827044786|ref|YP_009141061.1| photosystem II protein
I (chloroplast) [Sartidia perrieri]
gi|827044871|ref|YP_009141144.1| photosystem II protein
I (chloroplast) [Sartidia dewinteri]
gi|827045515|ref|YP_009141847.1| photosystem II protein
I (chloroplast) [Xerophyllum tenax]
gi|827045603|ref|YP_009141934.1| photosystem II protein
I (chloroplast) [Heloniopsis tubiflora]
gi|827045705|ref|YP_009142034.1| PsbI (chloroplast)
[Fagopyrum tataricum] gi|827046255|ref|YP_009142556.1|
photosystem II protein I (plastid) [Trillium cuneatum]
gi|836613814|ref|YP_009143623.1| photosystem II protein
I (chloroplast) [Salicornia brachiata]
gi|836613913|ref|YP_009143707.1| photosystem II protein
I (chloroplast) [Salicornia europaea]
gi|836614297|ref|YP_009144758.1| photosystem II protein
I (chloroplast) [Elleanthus sodiroi]
gi|836642787|ref|YP_009143791.1| photosystem II protein
I (chloroplast) [Salicornia bigelovii]
gi|836642870|ref|YP_009143873.1| photosystem II protein
I (plastid) [Cypripedium japonicum]
gi|836643266|ref|YP_009144330.1| photosystem II protein
I (plastid) [Carex siderosticta]
gi|836643450|ref|YP_009144499.1| photosystem II protein
I (chloroplast) [Rosmarinus officinalis]
gi|836643759|ref|YP_009144963.1| photosystem II protein
I (chloroplast) [Dieffenbachia seguine]
gi|836643828|ref|YP_009145245.1| photosystem II protein
I (plastid) [Trillium decumbens]
gi|836692098|ref|YP_009143537.1| PSII I protein
(chloroplast) [Cannabis sativa]
gi|849123841|ref|YP_009154394.1| photosystem II protein
I (chloroplast) [Populus tremula]
gi|544170655|ref|AP_004912.1| photosystem II protein I
(chloroplast) [Solanum lycopersicum]
gi|32469670|sp|P59762.1|PSBI_ATRBE RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Atropa belladonna]
gi|49065794|sp|P62100.1|PSBI_ARATH RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|49065795|sp|P62101.1|PSBI_MAIZE RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Zea mays]
gi|49065796|sp|P62102.1|PSBI_TOBAC RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Nicotiana tabacum]
gi|49065797|sp|P62103.1|PSBI_SPIOL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Spinacia oleracea]
gi|49065798|sp|P62104.1|PSBI_WHEAT RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|49065799|sp|P62105.1|PSBI_LOTJA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Lotus japonicus]
gi|49065800|sp|P62106.1|PSBI_OENEH RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Oenothera elata subsp. hookeri]
gi|49065801|sp|P62107.1|PSBI_SECCE RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|49065802|sp|P62108.1|PSBI_SINAL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Sinapis alba]
gi|61214905|sp|Q68S22.1|PSBI_PANGI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Panax ginseng]
gi|61214961|sp|Q6ENY3.1|PSBI_SACOF RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Saccharum officinarum]
gi|61214969|sp|Q6EW64.1|PSBI_NYMAL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Nymphaea alba]
gi|61215189|sp|Q7HKY2.1|PSBI_CALFG RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Calycanthus floridus var. glaucus]
gi|68052417|sp|Q56P16.1|PSBI_LACSA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Lactuca sativa]
gi|75261500|sp|Q6L3B2.1|PSBI_SACHY RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Saccharum sp.]
gi|75317332|sp|Q4VZP9.1|PSBI_CUCSA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Cucumis sativus]
gi|122153605|sp|A0A319.1|PSBI_COFAR RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Coffea arabica]
gi|122164296|sp|Q06FX7.1|PSBI_PELHO RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Pelargonium x hortorum]
gi|122164457|sp|Q06H13.1|PSBI_DRIGR RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Drimys granadensis]
gi|122165977|sp|Q09FX7.1|PSBI_NANDO RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Nandina domestica]
gi|122166051|sp|Q09G62.1|PSBI_PLAOC RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Platanus occidentalis]
gi|122166199|sp|Q09MJ4.1|PSBI_CITSI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Citrus sinensis]
gi|122166821|sp|Q09X33.1|PSBI_MORIN RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Morus indica]
gi|122179588|sp|Q1KXX5.1|PSBI_HELAN RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Helianthus annuus]
gi|122201380|sp|Q2L8Y9.1|PSBI_GOSHI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Gossypium hirsutum]
gi|122201795|sp|Q2MIB6.1|PSBI_SOLLC RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|122201837|sp|Q2MIK3.1|PSBI_SOLBU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Solanum bulbocastanum]
gi|122202492|sp|Q2PMS7.1|PSBI_SOYBN RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|122209901|sp|Q2VEJ2.1|PSBI_SOLTU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|122212918|sp|Q33C55.1|PSBI_NICTO RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Nicotiana tomentosiformis]
gi|122213446|sp|Q3BAQ8.1|PSBI_PHAAO RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Phalaenopsis aphrodite subsp. formosana]
gi|122213536|sp|Q3C1F9.1|PSBI_NICSY RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Nicotiana sylvestris]
gi|122217425|sp|Q3V550.1|PSBI_ACOCL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Acorus calamus]
gi|122219192|sp|Q49L14.1|PSBI_EUCGG RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Eucalyptus globulus subsp. globulus]
gi|122227492|sp|Q0G9X8.1|PSBI_DAUCA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Daucus carota]
gi|122242810|sp|Q0ZJ36.1|PSBI_VITVI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Vitis vinifera]
gi|122243419|sp|Q14FH3.1|PSBI_POPAL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Populus alba]
gi|125980841|sp|A1E9Z2.1|PSBI_AGRST RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|125980906|sp|A0ZZ19.1|PSBI_GOSBA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Gossypium barbadense]
gi|125980917|sp|Q0G9N5.2|PSBI_LIRTU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Liriodendron tulipifera]
gi|125980952|sp|A1E9Q8.1|PSBI_SORBI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Sorghum bicolor]
gi|126302588|sp|P25876.2|PSBI_HORVU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|156633560|sp|A4QJ99.1|PSBI_AETCO RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Aethionema cordifolium]
gi|156633561|sp|A4QJI3.1|PSBI_AETGR RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Aethionema grandiflorum]
gi|156633564|sp|A4QK02.1|PSBI_ARAHI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Arabis hirsuta]
gi|156633565|sp|A4QK89.1|PSBI_BARVE RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Barbarea verna]
gi|156633566|sp|A4QKH6.1|PSBI_CAPBU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Capsella bursa-pastoris]
gi|156633568|sp|A4QKR5.1|PSBI_CRUWA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Crucihimalaya wallichii]
gi|156633569|sp|A4QL03.1|PSBI_DRANE RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Draba nemorosa]
gi|156633571|sp|A4QLH8.1|PSBI_LOBMA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Lobularia maritima]
gi|156633572|sp|A4QLR7.1|PSBI_NASOF RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Nasturtium officinale]
gi|156633573|sp|A4QJZ6.1|PSBI_OLIPU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Olimarabidopsis pumila]
gi|156633574|sp|A4GGB3.1|PSBI_PHAVU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Phaseolus vulgaris]
gi|156633575|sp|A4GYP2.1|PSBI_POPTR RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Populus trichocarpa]
gi|156633581|sp|A1XGM2.1|PSBI_RANMC RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Ranunculus macranthus]
gi|212277040|sp|A9LYG9.1|PSBI_ACOAM RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Acorus americanus]
gi|212277042|sp|B3TNB7.1|PSBI_BRADI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|212277043|sp|A6MM20.1|PSBI_BUXMI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Buxus microphylla]
gi|212277044|sp|B1A919.1|PSBI_CARPA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Carica papaya]
gi|212277045|sp|A8SE55.1|PSBI_CERDE RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Ceratophyllum demersum]
gi|212277046|sp|A6MMA6.1|PSBI_CHLSC RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Chloranthus spicatus]
gi|212277055|sp|B0Z4N3.1|PSBI_OENAR RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Oenothera argillicola]
gi|212277056|sp|B0Z4W7.1|PSBI_OENBI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Oenothera biennis]
gi|212277057|sp|B0Z551.1|PSBI_OENGL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Oenothera glazioviana]
gi|212277058|sp|B0Z5D5.1|PSBI_OENPA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Oenothera parviflora]
gi|212277641|sp|A6MMJ1.1|PSBI_DIOEL RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Dioscorea elephantipes]
gi|212277642|sp|B2XWN3.1|PSBI_FAGEA RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Fagopyrum esculentum subsp. ancestrale]
gi|212277644|sp|B2LMH7.1|PSBI_GUIAB RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Guizotia abyssinica]
gi|212277646|sp|A7Y3A3.1|PSBI_IPOPU RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Ipomoea purpurea]
gi|212277647|sp|A9L980.1|PSBI_LEMMI RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Lemna minor]
gi|212277649|sp|A8Y9F4.1|PSBI_LOLPR RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
gi|212277650|sp|B1NWD4.1|PSBI_MANES RecName:
Full=Photosystem II reaction center protein I;
Short=PSII-I; AltName: Full=PSII 4.8 kDa protein
(chloroplast) [Manihot esculenta]
gi|12541|emb|CAA35617.1| unnamed protein product
[Sinapis alba] gi|14226|emb|CAA43849.1| I protein
(chloroplast) [Secale cereale] gi|14257|emb|CAA30562.1|
unnamed protein product (chloroplast) [Triticum
aestivum] gi|902205|emb|CAA60269.1| PSII I protein [Zea
mays] gi|5881678|dbj|BAA84369.1| PSII I protein
[Arabidopsis thaliana] gi|6723752|emb|CAB67161.1|
photosystem II protein I (chloroplast) [Oenothera elata
subsp. hookeri] gi|7636089|emb|CAB88709.1| PSII
I-protein (chloroplast) [Spinacia oleracea]
gi|13358985|dbj|BAB33202.1| PSII I protein [Lotus
japonicus] gi|13928189|dbj|BAB47018.1| PSII I protein
(chloroplast) [Triticum aestivum]
gi|20068315|emb|CAC88028.1| PSII I protein [Atropa
belladonna] gi|32399363|emb|CAD28705.1| PSII I protein
[Calycanthus floridus var. glaucus]
gi|48478660|gb|AAT44680.1| photosystem II protein I
[Saccharum hybrid cultivar SP80-3280]
gi|49659493|dbj|BAD27274.1| PSII I-protein [Saccharum
hybrid cultivar NCo 310] gi|50250311|emb|CAF28577.1|
PSII I protein [Nymphaea alba]
gi|51235297|gb|AAT98493.1| PSII I protein [Panax
ginseng] gi|58802767|gb|AAW82487.1| photosystem II
protein I [Phalaenopsis aphrodite subsp. formosana]
gi|60460793|gb|AAX21013.1| photosystem II protein I
(chloroplast) [Eucalyptus globulus subsp. globulus]
gi|61992018|gb|AAX58139.1| PSII I protein [Lactuca
sativa] gi|67511382|emb|CAJ00742.1| PSII I protein
[Cucumis sativus] gi|69217408|gb|AAZ04047.1| photosystem
II protein I [Nuphar advena] gi|74027086|gb|AAZ94636.1|
PSII I protein [Cucumis sativus]
gi|74381693|emb|CAI53778.1| PSII I protein [Acorus
calamus] gi|76559635|emb|CAJ32478.1| PSII I-protein
[Nicotiana tabacum] gi|77799541|dbj|BAE46630.1| PSII
I-protein [Nicotiana sylvestris]
gi|78100301|gb|ABB20942.1| PSII I protein [Morus indica]
gi|78675152|dbj|BAE47578.1| photosystem II protein psbI
protein [Lactuca sativa] gi|80750904|dbj|BAE47980.1|
PSII I-protein [Nicotiana tomentosiformis]
gi|82754613|gb|ABB90027.1| photosystem II protein I
[Solanum tuberosum] gi|83595750|gb|ABC25131.1|
photosystem II protein I [Glycine max]
gi|84371879|gb|ABC56197.1| photosystem II protein I
[Solanum bulbocastanum] gi|84371967|gb|ABC56284.1|
photosystem II protein I (chloroplast) [Solanum
lycopersicum] gi|84682188|gb|ABC60442.1| photosystem II
protein I [Nuphar advena] gi|85687400|gb|ABC73612.1|
photosystem II protein I [Gossypium hirsutum]
gi|88656788|gb|ABD47041.1| photosystem II protein I
[Solanum tuberosum] gi|88656879|gb|ABD47130.1|
photosystem II protein I (chloroplast) [Helianthus
annuus] gi|88656967|gb|ABD47217.1| photosystem II
protein I (chloroplast) [Lactuca sativa]
gi|88696754|gb|ABD48479.1| PSII I protein [Lemna minor]
gi|89241655|emb|CAJ32377.1| photosystem II protein I
[Solanum lycopersicum] gi|91701634|gb|ABE47518.1|
photosystem II protein I (chloroplast) [Vitis vinifera]
gi|109945501|dbj|BAE97189.1| photosystem II protein I
(chloroplast) [Populus alba] gi|112030982|gb|ABH88094.1|
photosystem II protein I [Phaseolus vulgaris]
gi|112032646|gb|ABH88281.1| photosystem II protein I
[Drimys granadensis] gi|112382052|gb|ABI17245.1|
photosystem II protein I [Pelargonium x hortorum]
gi|113200892|gb|ABI32408.1| photosystem II protein I
[Daucus carota] gi|113952606|gb|ABI49004.1| photosystem
II protein I [Citrus sinensis]
gi|114054368|gb|ABI49762.1| photosystem II protein I
[Platanus occidentalis] gi|114054454|gb|ABI49847.1|
photosystem II protein I [Nandina domestica]
gi|115498287|gb|ABI98729.1| photosystem II protein I
[Cucumis sativus] gi|116242148|gb|ABJ89663.1|
photosystem II protein I [Coffea arabica]
gi|118201026|gb|ABK79397.1| photosystem II protein I
(chloroplast) [Hordeum vulgare subsp. vulgare]
gi|118201110|gb|ABK79480.1| photosystem II protein I
[Sorghum bicolor] gi|118201195|gb|ABK79564.1|
photosystem II protein I (chloroplast) [Agrostis
stolonifera] gi|119224845|dbj|BAF41231.1| PSII I-protein
[Gossypium barbadense] gi|124074976|gb|ABC70740.2|
photosystem II protein I [Ranunculus macranthus]
gi|133712043|gb|ABO36686.1| photosystem II 48-kDa
truncated I protein [Populus trichocarpa]
gi|134286125|dbj|BAF49754.1| PSII I protein [Aethionema
cordifolium] gi|134286210|dbj|BAF49838.1| PSII I protein
[Aethionema grandiflorum] gi|134286296|dbj|BAF49923.1|
PSII I protein [Olimarabidopsis pumila]
gi|134286381|dbj|BAF50007.1| PSII I protein [Arabis
hirsuta] gi|134286469|dbj|BAF50094.1| PSII I protein
[Barbarea verna] gi|134286557|dbj|BAF50181.1| PSII I
protein [Capsella bursa-pastoris]
gi|134286647|dbj|BAF50270.1| PSII I protein
[Crucihimalaya wallichii] gi|134286736|dbj|BAF50358.1|
PSII I protein [Draba nemorosa]
gi|134286913|dbj|BAF50533.1| PSII I protein [Lobularia
maritima] gi|134287003|dbj|BAF50622.1| PSII I protein
[Nasturtium officinale] gi|146744172|gb|ABQ43244.1|
photosystem II protein I [Chloranthus spicatus]
gi|146762269|gb|ABQ45233.1| photosystem II protein I
[Buxus microphylla] gi|148508427|gb|ABQ81434.1|
photosystem II protein I [Ceratophyllum demersum]
gi|148668030|gb|ABR01414.1| photosystem II protein I
[Dioscorea elephantipes] gi|156597937|gb|ABU85236.1|
photosystem II protein I [Anethum graveolens]
gi|156598445|gb|ABU85482.1| photosystem II protein I
[Musa acuminata] gi|157056742|gb|ABV02332.1| photosystem
II protein I [Ipomoea purpurea]
gi|157695869|gb|ABV66138.1| photosystem II protein I
[Manihot esculenta] gi|158187141|gb|ABW22774.1|
photosystem II protein I [Phaseolus vulgaris]
gi|158934382|emb|CAO85960.1| photosystem II protein I
(chloroplast) [Lolium perenne]
gi|159792955|gb|ABW98711.1| photosystem II protein I
(chloroplast) [Oenothera argillicola]
gi|159793125|gb|ABW98879.1| photosystem II protein I
(chloroplast) [Oenothera biennis]
gi|159895479|gb|ABX10044.1| photosystem II protein I
(chloroplast) [Oenothera glazioviana]
gi|159895564|gb|ABX10128.1| photosystem II protein I
(chloroplast) [Oenothera parviflora]
gi|160369837|gb|ABX38728.1| photosystem II protein I
[Acorus americanus] gi|166065341|gb|ABY79716.1|
photosystem II protein I [Fagopyrum esculentum subsp.
ancestrale] gi|166344116|gb|ABY86766.1| photosystem II
protein I [Carica papaya] gi|179366240|gb|ACB86511.1|
photosystem II protein I [Guizotia abyssinica]
gi|193075542|gb|ACF08625.1| PSII I protein (chloroplast)
[Brachypodium distachyon] gi|197131972|gb|ACH47504.1|
photosystem II protein I [Erodium chrysanthum]
gi|197131974|gb|ACH47505.1| photosystem II protein I
[Erodium texanum] gi|197131986|gb|ACH47511.1|
photosystem II protein I [Pelargonium cotyledonis]
gi|209361316|gb|ACI43231.1| photosystem II protein I
[Coix lacryma-jobi] gi|215882313|gb|ACJ70743.1|
photosystem II protein I (chloroplast) [Festuca
arundinacea] gi|224474118|gb|ACN49307.1| photosystem II
protein I [Nelumbo lutea] gi|224474206|gb|ACN49392.1|
photosystem II protein I (chloroplast) [Nelumbo
nucifera] gi|224979549|gb|ACN72676.1| psbI [Jatropha
curcas] gi|226933866|gb|ACO91999.1| photosystem II
protein I [Megaleranthis saniculifolia]
gi|227481103|emb|CAP62482.1| PSII I protein
[Ceratophyllum demersum] gi|246367051|gb|ACS94662.1|
Psbl (chloroplast) [Bambusa oldhamii]
gi|251765236|gb|ACT15390.1| photosystem II protein I
[Anomochloa marantoidea] gi|254833093|gb|ACT83096.1|
photosystem II protein I [Oncidium hybrid cultivar]
gi|255040244|gb|ACT99904.1| photosystem II protein I
(chloroplast) [Dendrocalamus latiflorus]
gi|259020021|gb|ACV90219.1| photosystem II protein I
[Vigna radiata] gi|262400727|gb|ACY66216.1| photosystem
II protein I [Brassica napus]
gi|269924881|gb|ACZ52754.1| photosystem II protein I
[Parthenium argentatum] gi|281371756|gb|ADA63683.1|
photosystem II protein I [Typha latifolia]
gi|281428671|gb|ADA69910.1| PSII I protein (chloroplast)
[Olea europaea] gi|289645559|gb|ADD13622.1| photosystem
II protein I (chloroplast) [Anthriscus cerefolium]
gi|290488564|gb|ADD30666.1| photosystem II protein I
(chloroplast) [Antirrhinum majus]
gi|290488566|gb|ADD30667.1| photosystem II protein I
(chloroplast) [Aucuba japonica]
gi|290488568|gb|ADD30668.1| photosystem II protein I
(chloroplast) [Dillenia indica]
gi|290488570|gb|ADD30669.1| photosystem II protein I
(chloroplast) [Ehretia acuminata]
gi|290488572|gb|ADD30670.1| photosystem II protein I
(chloroplast) [Ilex cornuta] gi|290488574|gb|ADD30671.1|
photosystem II protein I (chloroplast) [Lonicera
japonica] gi|290488578|gb|ADD30673.1| photosystem II
protein I (chloroplast) [Nelumbo nucifera]
gi|290488580|gb|ADD30674.1| photosystem II protein I
(chloroplast) [Nerium oleander]
gi|290488588|gb|ADD30678.1| photosystem II protein I
(chloroplast) [Berberidopsis corallina]
gi|290488590|gb|ADD30679.1| photosystem II protein I
(chloroplast) [Bulnesia arborea]
gi|290488592|gb|ADD30680.1| photosystem II protein I
(chloroplast) [Cornus florida]
gi|290488594|gb|ADD30681.1| photosystem II protein I
(chloroplast) [Euonymus americanus]
gi|290488598|gb|ADD30683.1| photosystem II protein I
(chloroplast) [Gunnera manicata]
gi|290488600|gb|ADD30684.1| photosystem II protein I
(chloroplast) [Heuchera sanguinea]
gi|290488602|gb|ADD30685.1| photosystem II protein I
(chloroplast) [Liquidambar styraciflua]
gi|290488604|gb|ADD30686.1| photosystem II protein I
(chloroplast) [Oxalis latifolia]
gi|290488606|gb|ADD30687.1| photosystem II protein I
(chloroplast) [Plumbago auriculata]
gi|290488610|gb|ADD30689.1| photosystem II protein I
(chloroplast) [Staphylea colchica]
gi|290488612|gb|ADD30690.1| photosystem II protein I
(chloroplast) [Trochodendron aralioides]
gi|290775776|gb|ADD62272.1| photosystem II protein I
[Gossypium thurberi] gi|291059237|gb|ADD72073.1|
photosystem II protein I [Olea europaea]
gi|296936655|gb|ADH94327.1| photosystem II protein I
[Syzygium cumini] gi|299033932|gb|ADD63158.2|
photosystem II protein I (chloroplast) [Phoenix
dactylifera] gi|300069211|gb|ADJ66333.1| photosystem II
protein I [Erodium texanum] gi|302024833|gb|ADK89677.1|
photosystem II protein I (chloroplast) [Hydrocotyle
verticillata] gi|302024919|gb|ADK89762.1| photosystem II
protein I (chloroplast) [Tiedemannia filiformis subsp.
greenmannii] gi|302025005|gb|ADK89847.1| photosystem II
protein I (chloroplast) [Crithmum maritimum]
gi|302025094|gb|ADK89935.1| photosystem II protein I
(chloroplast) [Petroselinum crispum]
gi|307133871|gb|ADN32876.1| photosystem II protein I
(chloroplast) [Phyllostachys nigra var. henonis]
gi|307697267|gb|ADN86088.1| photosystem II protein I
[Chasmanthium latifolium] gi|308156067|gb|ADO15395.1|
photosystem II protein I [Jacobaea vulgaris]
gi|308223269|gb|ADO23577.1| photosystem II protein I
[Eucalyptus grandis] gi|308523491|gb|ADO33541.1|
photosystem II protein I [Hevea brasiliensis]
gi|308742581|gb|ADO33432.1| photosystem II protein I
[Smilax china] gi|309252874|gb|ADO60294.1| PSII I
protein [Corynocarpus laevigata]
gi|309321251|gb|ADO64794.1| photosystem II protein I
[Theobroma cacao] gi|309321418|gb|ADO64959.1|
photosystem II protein I [Prunus persica]
gi|309321602|gb|ADO65127.1| photosystem II protein I
(chloroplast) [Acidosasa purpurea]
gi|309321686|gb|ADO65210.1| photosystem II protein I
[Ferrocalamus rimosivaginus] gi|309321770|gb|ADO65293.1|
photosystem II protein I [Indocalamus longiauritus]
gi|309321853|gb|ADO65375.1| photosystem II protein I
(chloroplast) [Phyllostachys edulis]
gi|309321938|gb|ADO65459.1| photosystem II protein I
(chloroplast) [Bambusa emeiensis]
gi|316926278|gb|ADU58131.1| photosystem II protein I
[Erodium carvifolium] gi|318084301|gb|ADV38777.1|
photosystem II protein I (chloroplast) [Gossypium
arboreum] gi|318084385|gb|ADV38860.1| photosystem II
protein I (chloroplast) [Gossypium darwinii]
gi|318084469|gb|ADV38943.1| photosystem II protein I
(chloroplast) [Gossypium herbaceum subsp. africanum]
gi|318084553|gb|ADV39026.1| photosystem II protein I
(chloroplast) [Gossypium mustelinum]
gi|318084636|gb|ADV39108.1| photosystem II protein I
(chloroplast) [Gossypium raimondii]
gi|318084721|gb|ADV39192.1| photosystem II protein I
(chloroplast) [Gossypium tomentosum]
gi|319412303|gb|ADV41839.1| photosystem II protein I
(chloroplast) [Panicum virgatum]
gi|319412390|gb|ADV41925.1| photosystem II protein I
(chloroplast) [Panicum virgatum]
gi|326200265|gb|ADZ52304.1| photosystem II protein I
(chloroplast) [Asclepias syriaca]
gi|326457024|gb|ADZ74288.1| photosystem II protein I
[Gossypium anomalum] gi|326457111|gb|ADZ74374.1|
photosystem II protein I [Gossypium bickii]
gi|326457199|gb|ADZ74461.1| photosystem II protein I
[Gossypium herbaceum] gi|326457286|gb|ADZ74547.1|
photosystem II protein I [Gossypium longicalyx]
gi|326457373|gb|ADZ74633.1| photosystem II protein I
[Gossypium stocksii] gi|326457460|gb|ADZ74719.1|
photosystem II protein I [Gossypium sturtianum]
gi|328795417|emb|CBR30298.1| photosystem II protein I
[Olea europaea subsp. europaea]
gi|329124566|gb|AEB72123.1| photosystem II protein I
(chloroplast) [Solanum tuberosum]
gi|329124653|gb|AEB72209.1| photosystem II protein I
(chloroplast) [Solanum tuberosum]
gi|329317057|gb|AEB90416.1| photosystem II protein I
(chloroplast) [Gossypium gossypioides]
gi|329317141|gb|AEB90499.1| photosystem II protein I
(chloroplast) [Gossypium hirsutum]
gi|329317225|gb|AEB90582.1| photosystem II protein I
(chloroplast) [Gossypium hirsutum]
gi|329317309|gb|AEB90665.1| photosystem II protein I
(chloroplast) [Gossypium barbadense]
gi|329317393|gb|AEB90748.1| photosystem II protein I
(chloroplast) [Gossypium barbadense]
gi|329317477|gb|AEB90831.1| photosystem II protein I
(chloroplast) [Gossypium barbadense]
gi|329668843|gb|AEB96290.1| photosystem II protein I
(chloroplast) [Phalaenopsis equestris]
gi|334084385|emb|CBR23811.1| photosystem II protein I
[Olea europaea subsp. cuspidata]
gi|334084471|emb|CBR24604.1| photosystem II protein I
[Olea europaea subsp. europaea]
gi|334084557|emb|CBR30389.1| photosystem II protein I
[Olea europaea subsp. europaea]
gi|334084643|emb|CBS29334.1| photosystem II protein I
[Olea woodiana subsp. woodiana]
gi|334084848|emb|CBS29220.1| photosystem II protein I
[Olea europaea subsp. maroccana]
gi|334084934|emb|CBJ04282.1| photosystem II protein I
[Olea europaea subsp. cuspidata]
gi|334085020|emb|CBR23721.1| photosystem II protein I
[Olea europaea subsp. cuspidata]
gi|334089657|gb|AEG64540.1| photosystem II protein I
(chloroplast) [Ageratina adenophora]
gi|335354317|gb|AEH42937.1| photosystem II protein I
[Gossypium incanum] gi|335354401|gb|AEH43020.1|
photosystem II protein I [Gossypium somalense]
gi|335354485|gb|AEH43103.1| photosystem II protein I
(chloroplast) [Gossypium capitis-viridis]
gi|335354569|gb|AEH43186.1| photosystem II protein I
(chloroplast) [Gossypium areysianum]
gi|335354653|gb|AEH43269.1| photosystem II protein I
[Gossypium robinsonii] gi|339431288|gb|AEJ72482.1|
photosystem II protein I (chloroplast) [Erycina pusilla]
gi|339516149|gb|AEJ82539.1| photosystem II protein I
[Ricinus communis] gi|340536623|gb|AEK48390.1|
photosystem II protein I (chloroplast) [Colocasia
esculenta] gi|340536710|gb|AEK48476.1| photosystem II
protein I (chloroplast) [Colocasia esculenta]
gi|341834055|gb|AEK94326.1| photosystem II protein I
(chloroplast) [Spirodela polyrhiza]
gi|341834139|gb|AEK94409.1| photosystem II protein I
[Wolffiella lingulata] gi|341834223|gb|AEK94492.1|
photosystem II protein I [Wolffia australiana]
gi|344030475|gb|AEM76876.1| photosystem II protein I
[Cucumis melo subsp. melo] gi|345433545|dbj|BAK69367.1|
photosystem IIprotein I [Pyrus pyrifolia]
gi|346228372|gb|AEO21245.1| photosystem II protein I
(chloroplast) [Phyllostachys propinqua]
gi|347448190|gb|AEO92602.1| photosystem II protein I
(chloroplast) [Eleutherococcus senticosus]
gi|347448279|gb|AEO92690.1| photosystem II protein I
(chloroplast) [Sesamum indicum]
gi|347453884|gb|AEO95542.1| photosystem II protein I
(chloroplast) [Nicotiana undulata]
gi|347453995|gb|AEO95652.1| photosystem II protein I
[synthetic construct] gi|349589906|gb|AEP94877.1|
photosystem II protein I [Vigna unguiculata]
gi|350996410|gb|AEQ36922.1| photosystem II protein I
(chloroplast) [Datura stramonium]
gi|350996497|gb|AEQ37008.1| photosystem II protein I
[Datura stramonium] gi|355331708|gb|AER52397.1|
photosystem II protein I [Asclepias albicans]
gi|355331791|gb|AER52479.1| photosystem II protein I
[Asclepias albicans] gi|355331874|gb|AER52561.1|
photosystem II protein I [Asclepias coulteri]
gi|355331957|gb|AER52643.1| photosystem II protein I
[Asclepias cutleri] gi|355332040|gb|AER52725.1|
photosystem II protein I [Asclepias cutleri]
gi|355332123|gb|AER52807.1| photosystem II protein I
[Asclepias leptopus] gi|355332205|gb|AER52888.1|
photosystem II protein I [Asclepias macrotis]
gi|355332286|gb|AER52968.1| photosystem II protein I
[Asclepias macrotis] gi|355332365|gb|AER53046.1|
photosystem II protein I [Asclepias masonii]
gi|355332448|gb|AER53128.1| photosystem II protein I
[Asclepias subaphylla] gi|355332531|gb|AER53210.1|
photosystem II protein I [Asclepias subaphylla]
gi|355332610|gb|AER53288.1| photosystem II protein I
[Asclepias subulata] gi|355332693|gb|AER53370.1|
photosystem II protein I [Asclepias subulata]
gi|355332776|gb|AER53452.1| photosystem II protein I
[Asclepias albicans x Asclepias subulata]
gi|355469616|gb|AER93314.1| psbI [Platanthera
algeriensis] gi|355469618|gb|AER93315.1| psbI
[Platanthera chlorantha] gi|355469620|gb|AER93316.1|
psbI [Platanthera algeriensis]
gi|355469622|gb|AER93317.1| psbI [Platanthera
chlorantha] gi|355469624|gb|AER93318.1| psbI
[Platanthera bifolia] gi|355469626|gb|AER93319.1| psbI
[Platanthera bifolia] gi|355469628|gb|AER93320.1| psbI
[Platanthera bifolia] gi|355469630|gb|AER93321.1| psbI
[Platanthera bifolia] gi|355469632|gb|AER93322.1| psbI
[Platanthera bifolia] gi|355469634|gb|AER93323.1| psbI
[Platanthera bifolia] gi|355469636|gb|AER93324.1| psbI
[Platanthera bifolia] gi|355469638|gb|AER93325.1| psbI
[Platanthera bifolia] gi|355469640|gb|AER93326.1| psbI
[Platanthera bifolia] gi|355469642|gb|AER93327.1| psbI
[Platanthera chlorantha] gi|355469644|gb|AER93328.1|
psbI [Platanthera chlorantha]
gi|355469646|gb|AER93329.1| psbI [Platanthera
chlorantha] gi|355469648|gb|AER93330.1| psbI
[Platanthera chlorantha] gi|355469650|gb|AER93331.1|
psbI [Platanthera bifolia var. kuenkelei]
gi|355469652|gb|AER93332.1| psbI [Platanthera bifolia
var. kuenkelei] gi|355469654|gb|AER93333.1| psbI
[Platanthera bifolia var. kuenkelei]
gi|355469656|gb|AER93334.1| psbI [Platanthera bifolia
var. kuenkelei] gi|356474836|gb|AET11354.1| photosystem
II protein I (chloroplast) [Millettia pinnata]
gi|367056570|gb|AEX10179.1| photosystem II protein I
[California macrophylla] gi|371532608|gb|AEX31718.1|
PSII I protein (chloroplast) [Pentactina rupicola]
gi|371925921|gb|AEX57711.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926003|gb|AEX57792.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926085|gb|AEX57873.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926167|gb|AEX57954.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926249|gb|AEX58035.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926331|gb|AEX58116.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926413|gb|AEX58197.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926495|gb|AEX58278.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926577|gb|AEX58359.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|371926659|gb|AEX58440.1| photosystem II protein I
(chloroplast) [Theobroma grandiflorum]
gi|371926741|gb|AEX58521.1| photosystem II protein I
(chloroplast) [Theobroma cacao]
gi|372483572|gb|AEX95428.1| photosystem II protein I
(chloroplast) [Agapanthus africanus]
gi|372483574|gb|AEX95429.1| photosystem II protein I
(chloroplast) [Anemarrhena asphodeloides]
gi|372483576|gb|AEX95430.1| photosystem II protein I
(chloroplast) [Camassia scilloides]
gi|372483578|gb|AEX95431.1| photosystem II protein I
(chloroplast) [Echeandia sp. Steele 1101]
gi|372483580|gb|AEX95432.1| photosystem II protein I
(chloroplast) [Hosta ventricosa]
gi|372483582|gb|AEX95433.1| photosystem II protein I
(chloroplast) [Manfreda virginica]
gi|372483584|gb|AEX95434.1| photosystem II protein I
(chloroplast) [Polianthes sp. Pires 2011-05]
gi|372483590|gb|AEX95437.1| photosystem II protein I
(chloroplast) [Gilliesia graminea]
gi|372483594|gb|AEX95439.1| photosystem II protein I
(chloroplast) [Amaryllis belladonna]
gi|372483596|gb|AEX95440.1| photosystem II protein I
(chloroplast) [Crinum asiaticum]
gi|372483598|gb|AEX95441.1| photosystem II protein I
(chloroplast) [Eucharis x grandiflora]
gi|372483600|gb|AEX95442.1| photosystem II protein I
(chloroplast) [Scadoxus cinnabarinus]
gi|372483602|gb|AEX95443.1| photosystem II protein I
(chloroplast) [Aphyllanthes monspeliensis]
gi|372483604|gb|AEX95444.1| photosystem II protein I
(chloroplast) [Asparagus officinalis]
gi|372483606|gb|AEX95445.1| photosystem II protein I
(chloroplast) [Asparagus asparagoides]
gi|372483608|gb|AEX95446.1| photosystem II protein I
(chloroplast) [Hemiphylacus alatostylus]
gi|372483610|gb|AEX95447.1| photosystem II protein I
(chloroplast) [Aloe vera] gi|372483612|gb|AEX95448.1|
photosystem II protein I (chloroplast) [Asphodeline
damascena] gi|372483614|gb|AEX95449.1| photosystem II
protein I (chloroplast) [Haworthia cymbiformis]
gi|372483616|gb|AEX95450.1| photosystem II protein I
(chloroplast) [Kniphofia linearifolia]
gi|372483618|gb|AEX95451.1| photosystem II protein I
(chloroplast) [Doryanthes palmeri]
gi|372483620|gb|AEX95452.1| photosystem II protein I
(chloroplast) [Phormium tenax]
gi|372483624|gb|AEX95454.1| photosystem II protein I
(chloroplast) [Drimia altissima]
gi|372483626|gb|AEX95455.1| photosystem II protein I
(chloroplast) [Ledebouria cordifolia]
gi|372483628|gb|AEX95456.1| photosystem II protein I
(chloroplast) [Ornithogalum tenuifolium]
gi|372483632|gb|AEX95458.1| photosystem II protein I
(chloroplast) [Iris tenax] gi|372483634|gb|AEX95459.1|
photosystem II protein I (chloroplast) [Cordyline
australis] gi|372483636|gb|AEX95460.1| photosystem II
protein I (chloroplast) [Trichopetalum plumosum]
gi|372483638|gb|AEX95461.1| photosystem II protein I
(chloroplast) [Beaucarnea hookeri]
gi|372483640|gb|AEX95462.1| photosystem II protein I
(chloroplast) [Dasylirion wheeleri]
gi|372483642|gb|AEX95463.1| photosystem II protein I
(chloroplast) [Eriospermum cervicorne]
gi|372483644|gb|AEX95464.1| photosystem II protein I
(chloroplast) [Liriope spicata]
gi|372483646|gb|AEX95465.1| photosystem II protein I
(chloroplast) [Ophiopogon japonicus]
gi|372483648|gb|AEX95466.1| photosystem II protein I
(chloroplast) [Ruscus aculeatus]
gi|372483650|gb|AEX95467.1| photosystem II protein I
(chloroplast) [Sansevieria trifasciata]
gi|372483652|gb|AEX95468.1| photosystem II protein I
(chloroplast) [Maianthemum stellatum]
gi|372483654|gb|AEX95469.1| photosystem II protein I
(chloroplast) [Androstephium coeruleum]
gi|372483656|gb|AEX95470.1| photosystem II protein I
(chloroplast) [Brodiaea californica]
gi|372483658|gb|AEX95471.1| photosystem II protein I
(chloroplast) [Dichelostemma capitatum]
gi|372483660|gb|AEX95472.1| photosystem II protein I
(chloroplast) [Dichelostemma congestum]
gi|372483662|gb|AEX95473.1| photosystem II protein I
(chloroplast) [Dichelostemma ida-maia]
gi|372483664|gb|AEX95474.1| photosystem II protein I
(chloroplast) [Triteleia hyacinthina]
gi|372483666|gb|AEX95475.1| photosystem II protein I
(chloroplast) [Xanthorrhoea preissii]
gi|372483668|gb|AEX95476.1| photosystem II protein I
(chloroplast) [Xeronema callistemon]
gi|372863190|gb|AEX99262.1| photosystem II protein I
(chloroplast) [Chrysanthemum indicum]
gi|372863429|gb|AEX99498.1| photosystem II protein I
(chloroplast) [Chrysanthemum indicum]
gi|374094580|gb|AEY84636.1| photosystem II protein I
(chloroplast) [Elodea canadensis]
gi|374256993|gb|AEZ01411.1| photosystem II protein I
(chloroplast) [Japonolirion osense]
gi|374975062|gb|AFA27622.1| photosystem II protein I
[Agapanthus praecox] gi|374975064|gb|AFA27623.1|
photosystem II protein I [Albuca kirkii]
gi|374975080|gb|AFA27631.1| photosystem II protein I
[Molineria capitulata] gi|374975084|gb|AFA27633.1|
photosystem II protein I [Dasypogon bromeliifolius]
gi|374975110|gb|AFA27646.1| photosystem II protein I
[Lomandra longifolia] gi|374975129|gb|AFA27655.1|
photosystem II protein I, partial [Renealmia alpinia]
gi|375298819|gb|AFA45258.1| photosystem II protein I
(chloroplast) [Chrysanthemum x morifolium]
gi|383286781|gb|AFH01431.1| photosystem II protein I
(chloroplast) [Nelumbo nucifera]
gi|383286877|gb|AFH01526.1| photosystem II protein I
(chloroplast) [Nelumbo lutea]
gi|383832154|gb|AFH53878.1| PsbI [Harrisia regelii]
gi|384406836|gb|AFH89493.1| photosystem II protein I
(chloroplast) [Aegilops tauschii]
gi|386268349|gb|AFJ00455.1| photosystem II protein I
[Francoa sonchifolia] gi|387598476|gb|AFJ91868.1|
photosystem II protein I (chloroplast) [Vigna
unguiculata] gi|388893191|gb|AFK81283.1| photosystem II
protein I [Camellia sinensis var. assamica]
gi|388893279|gb|AFK81370.1| photosystem II protein I
[Camellia oleifera] gi|388893367|gb|AFK81457.1|
photosystem II protein I [Camellia taliensis]
gi|392841322|gb|AFM83277.1| photosystem II protein I
(chloroplast) [Kingia australis]
gi|394986476|gb|AFN42357.1| photosystem II protein I
(chloroplast) [Aegilops speltoides]
gi|401065916|gb|AFP90760.1| photosystem II protein I
(chloroplast) [Capsicum annuum]
gi|401712180|gb|AFP98805.1| photosystem II protein psbI
protein (chloroplast) [Artemisia frigida]
gi|401879726|gb|AFQ30913.1| photosystem II protein I
(chloroplast) [Salvia miltiorrhiza]
gi|402797513|gb|AFQ99045.1| photosystem II protein I
(chloroplast) [Sedum sarmentosum]
gi|403226765|gb|AFR25644.1| photosystem II protein I
(chloroplast) [Penthorum chinense]
gi|407030066|gb|AFS67049.1| photosystem II protein I
(chloroplast) [Arundinaria fargesii]
gi|407030150|gb|AFS67132.1| photosystem II protein I
(chloroplast) [Sarocalamus faberi]
gi|407030235|gb|AFS67216.1| photosystem II protein I
(chloroplast) [Chimonocalamus longiusculus]
gi|407030318|gb|AFS67298.1| photosystem II protein I
(chloroplast) [Fargesia nitida]
gi|407030402|gb|AFS67381.1| photosystem II protein I
(chloroplast) [Fargesia spathacea]
gi|407030486|gb|AFS67464.1| photosystem II protein I
(chloroplast) [Fargesia yunnanensis]
gi|407030570|gb|AFS67547.1| photosystem II protein I
(chloroplast) [Gaoligongshania megalothyrsa]
gi|407030654|gb|AFS67630.1| photosystem II protein I
(chloroplast) [Gelidocalamus tessellatus]
gi|407030738|gb|AFS67713.1| photosystem II protein I
(chloroplast) [Indocalamus wilsonii]
gi|407030822|gb|AFS67796.1| photosystem II protein I
(chloroplast) [Indosasa sinica]
gi|407030905|gb|AFS67878.1| photosystem II protein I
(chloroplast) [Oligostachyum shiuyingianum]
gi|407030988|gb|AFS67960.1| photosystem II protein I
(chloroplast) [Pleioblastus maculatus]
gi|407031071|gb|AFS68042.1| photosystem II protein I
(chloroplast) [Thamnocalamus spathiflorus]
gi|407031155|gb|AFS68125.1| photosystem II protein I
(chloroplast) [Yushania levigata]
gi|408902565|gb|AFU95933.1| PsbI, partial (chloroplast)
[Averrhoa carambola] gi|408902569|gb|AFU95935.1| PsbI,
partial (chloroplast) [Bhesa sp. CCD-2012]
gi|408902571|gb|AFU95936.1| PsbI, partial (chloroplast)
[Caloncoba echinata] gi|408902573|gb|AFU95937.1| PsbI,
partial (chloroplast) [Casearia nitida]
gi|408902575|gb|AFU95938.1| PsbI, partial (chloroplast)
[Chrysobalanus icaco] gi|408902577|gb|AFU95939.1| PsbI,
partial (chloroplast) [Clusia rosea]
gi|408902579|gb|AFU95940.1| PsbI, partial (chloroplast)
[Elaeodendron orientale] gi|408902581|gb|AFU95941.1|
PsbI, partial (chloroplast) [Erythroxylum areolatum]
gi|408902583|gb|AFU95942.1| PsbI, partial (chloroplast)
[Euphorbia maculata] gi|408902585|gb|AFU95943.1| PsbI,
partial (chloroplast) [Flueggea suffruticosa]
gi|408902587|gb|AFU95944.1| PsbI, partial (chloroplast)
[Galearia maingayi] gi|408902589|gb|AFU95945.1| PsbI,
partial (chloroplast) [Garcinia mangostana]
gi|408902601|gb|AFU95951.1| PsbI, partial (chloroplast)
[Lacistema robustum] gi|408902605|gb|AFU95953.1| PsbI,
partial (chloroplast) [Mammea americana]
gi|408902607|gb|AFU95954.1| PsbI, partial (chloroplast)
[Microdesmis caseariifolia] gi|408902609|gb|AFU95955.1|
PsbI, partial (chloroplast) [Ouratea sp. CCD-2012]
gi|408902613|gb|AFU95957.1| PsbI, partial (chloroplast)
[Pera bumeliifolia] gi|408902615|gb|AFU95958.1| PsbI,
partial (chloroplast) [Phyllanthus urinaria]
gi|408902617|gb|AFU95959.1| PsbI, partial (chloroplast)
[Ploiarium sp. CCD-2012] gi|408902623|gb|AFU95962.1|
PsbI, partial (chloroplast) [Rhizophora mangle]
gi|408902625|gb|AFU95963.1| PsbI, partial (chloroplast)
[Scyphostegia borneensis] gi|410177750|gb|AFV62631.1|
photosystem II protein I [Festuca altissima]
gi|410177837|gb|AFV62717.1| photosystem II protein I
[Festuca ovina] gi|410177924|gb|AFV62803.1| photosystem
II protein I [Festuca pratensis]
gi|410178011|gb|AFV62889.1| photosystem II protein I
[Lolium multiflorum] gi|430728256|gb|AGA55580.1|
photosystem II protein I (chloroplast) [Camellia
sinensis] gi|438687588|emb|CCP47114.1| photosystem II
protein I (chloroplast) [Tectona grandis]
gi|438688272|emb|CCP47203.1| photosystem II protein I
(chloroplast) [Tectona grandis]
gi|438688396|emb|CCP47292.1| photosystem II protein I
(chloroplast) [Tectona grandis]
gi|441480235|gb|AGC38147.1| photosystem II protein I
(chloroplast) [Arundinaria gigantea]
gi|441480319|gb|AGC38230.1| photosystem II protein I
(chloroplast) [Cryptochloa strictiflora]
gi|442566137|gb|AGC56336.1| photosystem II protein I
(chloroplast) [Eucalyptus obliqua]
gi|442566223|gb|AGC56421.1| photosystem II protein I
(chloroplast) [Eucalyptus radiata]
gi|442566309|gb|AGC56506.1| photosystem II protein I
(chloroplast) [Eucalyptus delegatensis]
gi|442566395|gb|AGC56591.1| photosystem II protein I
(chloroplast) [Eucalyptus verrucata]
gi|442566481|gb|AGC56676.1| photosystem II protein I
(chloroplast) [Eucalyptus baxteri]
gi|442566567|gb|AGC56761.1| photosystem II protein I
(chloroplast) [Eucalyptus diversifolia]
gi|442566653|gb|AGC56846.1| photosystem II protein I
(chloroplast) [Eucalyptus sieberi]
gi|442566739|gb|AGC56931.1| photosystem II protein I
(chloroplast) [Eucalyptus elata]
gi|442566825|gb|AGC57016.1| photosystem II protein I
(chloroplast) [Eucalyptus regnans]
gi|442566911|gb|AGC57101.1| photosystem II protein I
(chloroplast) [Eucalyptus umbra]
gi|442566997|gb|AGC57186.1| photosystem II protein I
(chloroplast) [Eucalyptus cloeziana]
gi|442567083|gb|AGC57271.1| photosystem II protein I
(chloroplast) [Eucalyptus patens]
gi|442567169|gb|AGC57356.1| photosystem II protein I
(chloroplast) [Eucalyptus marginata]
gi|442567255|gb|AGC57441.1| photosystem II protein I
(chloroplast) [Eucalyptus curtisii]
gi|442567341|gb|AGC57526.1| photosystem II protein I
(chloroplast) [Eucalyptus melliodora]
gi|442567427|gb|AGC57611.1| photosystem II protein I
(chloroplast) [Eucalyptus melliodora]
gi|442567513|gb|AGC57696.1| photosystem II protein I
(chloroplast) [Eucalyptus polybractea]
gi|442567599|gb|AGC57781.1| photosystem II protein I
(chloroplast) [Eucalyptus cladocalyx]
gi|442567685|gb|AGC57866.1| photosystem II protein I
(chloroplast) [Eucalyptus globulus]
gi|442567771|gb|AGC57951.1| photosystem II protein I
(chloroplast) [Eucalyptus nitens]
gi|442567857|gb|AGC58036.1| photosystem II protein I
(chloroplast) [Eucalyptus aromaphloia]
gi|442567943|gb|AGC58121.1| photosystem II protein I
(chloroplast) [Eucalyptus saligna]
gi|442568029|gb|AGC58206.1| photosystem II protein I
(chloroplast) [Eucalyptus camaldulensis]
gi|442568115|gb|AGC58291.1| photosystem II protein I
(chloroplast) [Eucalyptus deglupta]
gi|442568201|gb|AGC58376.1| photosystem II protein I
(chloroplast) [Eucalyptus spathulata]
gi|442568287|gb|AGC58461.1| photosystem II protein I
(chloroplast) [Eucalyptus torquata]
gi|442568373|gb|AGC58546.1| photosystem II protein I
(chloroplast) [Eucalyptus diversicolor]
gi|442568459|gb|AGC58631.1| photosystem II protein I
(chloroplast) [Eucalyptus salmonophloia]
gi|442568545|gb|AGC58716.1| photosystem II protein I
(chloroplast) [Eucalyptus microcorys]
gi|442568631|gb|AGC58801.1| photosystem II protein I
(chloroplast) [Eucalyptus guilfoylei]
gi|442568717|gb|AGC58886.1| photosystem II protein I
(chloroplast) [Eucalyptus erythrocorys]
gi|442568803|gb|AGC58971.1| photosystem II protein I
(chloroplast) [Corymbia gummifera]
gi|442568889|gb|AGC59056.1| photosystem II protein I
(chloroplast) [Corymbia maculata]
gi|442568975|gb|AGC59141.1| photosystem II protein I
(chloroplast) [Corymbia eximia]
gi|442569061|gb|AGC59226.1| photosystem II protein I
(chloroplast) [Corymbia tessellaris]
gi|442569147|gb|AGC59311.1| photosystem II protein I
(chloroplast) [Angophora floribunda]
gi|442569233|gb|AGC59396.1| photosystem II protein I
(chloroplast) [Angophora costata]
gi|442569319|gb|AGC59481.1| photosystem II protein I
(chloroplast) [Allosyncarpia ternata]
gi|442569405|gb|AGC59566.1| photosystem II protein I
(chloroplast) [Stockwellia quadrifida]
gi|449326082|gb|AGE92668.1| photosystem II protein I
[Heliconia collinsiana] gi|449326515|gb|AGE93096.1|
photosystem II protein I [Dasypogon bromeliifolius]
gi|449326602|gb|AGE93182.1| photosystem II protein I
[Calectasia narragara] gi|449326776|gb|AGE93354.1|
photosystem II protein I [Alpinia zerumbet]
gi|449326863|gb|AGE93440.1| photosystem II protein I
[Xiphidium caeruleum] gi|456367954|gb|AGG36868.1|
photosystem II protein I (chloroplast) [Ardisia
polysticta] gi|458599074|gb|AGG38940.1| photosystem II
protein I (chloroplast) [Aralia undulata]
gi|458599176|gb|AGG39027.1| photosystem II protein I
(chloroplast) [Brassaiopsis hainla]
gi|458599355|gb|AGG39114.1| photosystem II protein I
(chloroplast) [Metapanax delavayi]
gi|458599508|gb|AGG39201.1| photosystem II protein I
(chloroplast) [Schefflera delavayi]
gi|458599596|gb|AGG39288.1| photosystem II protein I
(chloroplast) [Kalopanax septemlobus]
gi|469473987|gb|AGH33757.1| photosystem II protein I
(chloroplast) [Puelia olyriformis]
gi|469615482|gb|AGH62633.1| PsbI (chloroplast) [Panax
quinquefolius] gi|474452060|gb|AGI51128.1| photosystem
II protein I (chloroplast) (chloroplast) [Catharanthus
roseus] gi|474452176|gb|AGI51228.1| photosystem II
protein I (chloroplast) [Fritillaria taipaiensis]
gi|478620889|dbj|BAN14936.1| photosystem II protein I
(chloroplast) [Vigna angularis]
gi|479279187|gb|AGJ72041.1| photosystem II protein I
(chloroplast) [Tetracentron sinense]
gi|479279280|gb|AGJ72133.1| photosystem II protein I
(chloroplast) [Trochodendron aralioides]
gi|482662077|gb|AGK25306.1| photosystem II protein I
(chloroplast) [Cymbidium aloifolium]
gi|482662156|gb|AGK25384.1| photosystem II protein I
(chloroplast) [Cymbidium sinense]
gi|482662235|gb|AGK25462.1| photosystem II protein I
(chloroplast) [Cymbidium tortisepalum]
gi|482662314|gb|AGK25540.1| photosystem II protein I
(chloroplast) [Cymbidium tortisepalum]
gi|482662393|gb|AGK25618.1| photosystem II protein I
(chloroplast) [Cymbidium mannii]
gi|482662551|gb|AGK25774.1| photosystem II protein I
(chloroplast) [Cymbidium tortisepalum]
gi|482662630|gb|AGK25852.1| photosystem II protein I
(chloroplast) [Cymbidium mannii]
gi|485474318|gb|AGK82920.1| photosystem II protein I
(chloroplast) [Lupinus luteus]
gi|491650355|gb|AGL13415.1| photosystem II protein I
(chloroplast) [Liquidambar formosana]
gi|496538585|gb|AGL45320.1| PsbI (chloroplast) [Sesamum
indicum] gi|498921838|gb|AGL61059.1| photosystem II
protein I (chloroplast) [Utricularia gibba]
gi|500050329|gb|AGL79992.1| photosystem II protein I
(chloroplast) [Fritillaria taipaiensis]
gi|500050417|gb|AGL80075.1| photosystem II protein I
(chloroplast) [Fritillaria taipaiensis]
gi|507474309|gb|AGM48185.1| photosystem II protein I
(chloroplast) [Dendrobium catenatum]
gi|510934388|emb|CCQ09086.1| photosystem II protein I
(chloroplast) [Olea europaea subsp. europaea]
gi|511262210|gb|AGN72204.1| photosystem II protein I
(chloroplast) [Arundinaria appalachiana]
gi|511262294|gb|AGN72287.1| photosystem II protein I
(chloroplast) [Arundinaria tecta]
gi|511369807|gb|AGN73964.1| photosystem II protein I
(chloroplast) [Aconitum barbatum var. puberulum]
gi|514252905|gb|AGO44166.1| photosystem II protein I
(chloroplast) [Glycine cyrtoloba]
gi|514252987|gb|AGO44247.1| photosystem II protein I
(chloroplast) [Glycine tomentella]
gi|514253070|gb|AGO44329.1| photosystem II protein I
(chloroplast) [Glycine stenophita]
gi|514253153|gb|AGO44411.1| photosystem II protein I
(chloroplast) [Glycine canescens]
gi|514253236|gb|AGO44493.1| photosystem II protein I
(chloroplast) [Glycine dolichocarpa]
gi|514253319|gb|AGO44575.1| photosystem II protein I
(chloroplast) [Glycine falcata]
gi|514253402|gb|AGO44657.1| photosystem II protein I
(chloroplast) [Glycine syndetika]
gi|514253483|gb|AGO44737.1| photosystem II protein I
(chloroplast) [Glycine tomentella]
gi|519666896|gb|AGO98508.1| photosystem II protein I
(chloroplast) [Nelumbo nucifera]
gi|521300936|gb|AGP50739.1| photosystem II protein I
(chloroplast) [Hordeum vulgare subsp. vulgare]
gi|521301013|gb|AGP50815.1| photosystem II protein I
(chloroplast) [Hordeum vulgare subsp. spontaneum]
gi|521301094|gb|AGP50895.1| photosystem II protein I
(chloroplast) [Hordeum vulgare subsp. spontaneum]
gi|521301174|gb|AGP50974.1| photosystem II protein I
(chloroplast) [Triticum monococcum]
gi|521301254|gb|AGP51053.1| photosystem II protein I
(chloroplast) [Secale cereale]
gi|521301332|gb|AGP51130.1| photosystem II protein I
(chloroplast) [Triticum monococcum subsp. aegilopoides]
gi|521301410|gb|AGP51207.1| photosystem II protein I
(chloroplast) [Triticum urartu]
gi|521301471|gb|AGP51267.1| photosystem II protein I
(chloroplast) [Triticum aestivum]
gi|523706675|gb|AGQ55659.1| photosystem II protein I
(chloroplast) [Alstroemeria aurea]
gi|523706760|gb|AGQ55743.1| photosystem II protein I
(chloroplast) [Lilium longiflorum]
gi|525312441|emb|CCW72359.1| psbI (chloroplast) [Musa
acuminata subsp. malaccensis]
gi|527355124|gb|AGS12993.1| photosystem II protein I
[Melianthus villosus] gi|532164820|gb|AGT79830.1|
photosystem II protein I (chloroplast) [Andrographis
paniculata] gi|536462664|gb|AGU37029.1| photosystem II
protein I (chloroplast) [Berberis bealei]
gi|537366269|gb|AGU46450.1| photosystem II protein I
[Hyoscyamus niger] gi|540067287|gb|AGV02641.1|
photosystem II protein I (chloroplast) (chloroplast)
[Zea mays subsp. mays] gi|540067372|gb|AGV02725.1|
photosystem II protein I (chloroplast) (chloroplast)
[Zea mays subsp. mays] gi|540067571|gb|AGV02922.1|
photosystem II protein I (chloroplast) [Hypseocharis
bilobata] gi|540067631|gb|AGV02981.1| photosystem II
protein I (chloroplast) [Pelargonium alternans]
gi|544186323|gb|AGW04271.1| photosystem II protein I
[Secamone afzelii] gi|544186401|gb|AGW04348.1|
photosystem II protein I [Araujia sericifera]
gi|544186479|gb|AGW04425.1| photosystem II protein I
[Astephanus triflorus] gi|544186557|gb|AGW04502.1|
photosystem II protein I [Eustegia minuta]
gi|544186630|gb|AGW04574.1| photosystem II protein I
[Marsdenia astephanoides] gi|544186708|gb|AGW04651.1|
photosystem II protein I [Matelea biflora]
gi|544186786|gb|AGW04728.1| photosystem II protein I
[Orthosia scoparia] gi|544186864|gb|AGW04805.1|
photosystem II protein I [Sisyranthus trichostomus]
gi|544186942|gb|AGW04882.1| photosystem II protein I
[Telosma cordata] gi|544187020|gb|AGW04959.1|
photosystem II protein I [Vincetoxicum rossicum]
gi|544187173|gb|AGW05111.1| photosystem II protein I
(chloroplast) (chloroplast) [Asclepias nivea]
gi|544187193|gb|AGW05121.1| photosystem II protein I
(chloroplast) (chloroplast) [Asclepias syriaca]
gi|545484735|gb|AGW31927.1| photosystem II protein I
(chloroplast) [Panax ginseng]
gi|545691458|gb|AGW46724.1| photosystem II protein I
(chloroplast) (chloroplast) [Neyraudia reynaudiana]
gi|546352414|gb|AGW96321.1| photosystem II protein I
(chloroplast) [Ipomoea batatas]
gi|546352500|gb|AGW96406.1| photosystem II protein I
(chloroplast) [Ipomoea batatas]
gi|546352586|gb|AGW96491.1| photosystem II protein I
(chloroplast) [Ipomoea batatas]
gi|546352672|gb|AGW96576.1| photosystem II protein I
(chloroplast) [Ipomoea trifida]
gi|546352757|gb|AGW96660.1| photosystem II protein I
(chloroplast) [Argyreia nervosa]
gi|546352843|gb|AGW96745.1| photosystem II protein I
(chloroplast) [Ipomoea amnicola]
gi|546352929|gb|AGW96830.1| photosystem II protein I
(chloroplast) [Ipomoea argillicola]
gi|546353015|gb|AGW96915.1| photosystem II protein I
(chloroplast) [Ipomoea cairica]
gi|546353101|gb|AGW97000.1| photosystem II protein I
(chloroplast) [Ipomoea diamantinensis]
gi|546353187|gb|AGW97085.1| photosystem II protein I
(chloroplast) [Ipomoea dumetorum]
gi|546353273|gb|AGW97170.1| photosystem II protein I
(chloroplast) [Ipomoea eriocarpa]
gi|546353359|gb|AGW97255.1| photosystem II protein I
(chloroplast) [Ipomoea hederifolia]
gi|546353445|gb|AGW97340.1| photosystem II protein I
(chloroplast) [Ipomoea involucrata]
gi|546353531|gb|AGW97425.1| photosystem II protein I
(chloroplast) [Ipomoea murucoides]
gi|546353617|gb|AGW97510.1| photosystem II protein I
(chloroplast) [Ipomoea nil] gi|546353703|gb|AGW97595.1|
photosystem II protein I (chloroplast) [Ipomoea
orizabensis] gi|546353789|gb|AGW97680.1| photosystem II
protein I (chloroplast) [Ipomoea pedicellaris]
gi|546353875|gb|AGW97765.1| photosystem II protein I
(chloroplast) [Ipomoea pes-caprae]
gi|546353961|gb|AGW97850.1| photosystem II protein I
(chloroplast) [Ipomoea polpha]
gi|546354047|gb|AGW97935.1| photosystem II protein I
(chloroplast) [Ipomoea setosa]
gi|546354132|gb|AGW98019.1| photosystem II protein I
(chloroplast) [Ipomoea splendor-sylvae]
gi|546354218|gb|AGW98104.1| photosystem II protein I
(chloroplast) [Ipomoea ternifolia]
gi|546354304|gb|AGW98189.1| photosystem II protein I
(chloroplast) [Ipomoea tricolor]
gi|546354390|gb|AGW98274.1| photosystem II protein I
(chloroplast) [Ipomoea trifida]
gi|546354476|gb|AGW98359.1| photosystem II protein I
(chloroplast) [Ipomoea cordatotriloba]
gi|546354562|gb|AGW98444.1| photosystem II protein I
(chloroplast) [Ipomoea minutiflora]
gi|546354648|gb|AGW98529.1| photosystem II protein I
(chloroplast) [Ipomoea obscura]
gi|546354734|gb|AGW98614.1| photosystem II protein I
(chloroplast) [Ipomoea pes-tigridis]
gi|546354820|gb|AGW98699.1| photosystem II protein I
(chloroplast) [Merremia quinquefolia]
gi|546354906|gb|AGW98784.1| photosystem II protein I
(chloroplast) [Operculina macrocarpa]
gi|546354992|gb|AGW98869.1| photosystem II protein I
(chloroplast) [Stictocardia macalusoi]
gi|546355078|gb|AGW98954.1| photosystem II protein I
(chloroplast) [Turbina corymbosa]
gi|549531701|gb|AGX28827.1| photosystem II protein I
(chloroplast) [Veratrum patulum]
gi|550533632|dbj|BAO01476.1| photosystem II protein I
(chloroplast) [Vitis vinifera subsp. caucasica]
gi|550533718|dbj|BAO01560.1| photosystem II protein I
(chloroplast) [Vitis vinifera subsp. caucasica]
gi|550533803|dbj|BAO01644.1| photosystem II protein I
(chloroplast) [Vitis vinifera subsp. caucasica]
gi|553828993|gb|AGY60929.1| photosystem II protein I
[Erodium trifolium] gi|554515538|gb|AGY92841.1|
photosystem II protein I (chloroplast) [Aegilops
cylindrica] gi|554515616|gb|AGY92918.1| photosystem II
protein I (chloroplast) [Aegilops geniculata]
gi|555298124|gb|AGZ13224.1| photosystem II protein I
[Olyra latifolia] gi|555945903|gb|AGZ19130.1|
photosystem II protein I (chloroplast) [Camellia
sinensis] gi|557469735|gb|AHA03988.1| photosystem II
protein I (chloroplast) [Glycine soja]
gi|557636896|gb|AHA12498.1| photosystem II protein I
[Musa textilis] gi|557636983|gb|AHA12584.1| photosystem
II protein I [Ravenala madagascariensis]
gi|557637067|gb|AHA12667.1| photosystem II protein I
[Orchidantha fimbriata] gi|557637140|gb|AHA12739.1|
photosystem II protein I [Canna indica]
gi|557637225|gb|AHA12823.1| photosystem II protein I
[Maranta leuconeura] gi|557637311|gb|AHA12908.1|
photosystem II protein I [Monocostus uniflorus]
gi|557637398|gb|AHA12994.1| photosystem II protein I
[Costus pulverulentus] gi|557637572|gb|AHA13166.1|
photosystem II protein I [Thaumatococcus daniellii]
gi|558614274|gb|AHA82284.1| photosystem II protein I
(chloroplast) [Phragmites australis]
gi|558697164|gb|AHA84919.1| photosystem II protein I
[Ajuga reptans] gi|559767999|gb|AHB14441.1| photosystem
II protein I [Helianthus giganteus]
gi|559768085|gb|AHB14526.1| photosystem II protein I
[Helianthus giganteus] gi|559768171|gb|AHB14611.1|
photosystem II protein I [Helianthus giganteus]
gi|559768257|gb|AHB14696.1| photosystem II protein I
[Helianthus giganteus] gi|559768343|gb|AHB14781.1|
photosystem II protein I [Helianthus grosseserratus]
gi|559768429|gb|AHB14866.1| photosystem II protein I
[Helianthus grosseserratus] gi|559768515|gb|AHB14951.1|
photosystem II protein I [Helianthus divaricatus]
gi|559768601|gb|AHB15036.1| photosystem II protein I
[Helianthus divaricatus] gi|559768687|gb|AHB15121.1|
photosystem II protein I [Helianthus divaricatus]
gi|559768773|gb|AHB15206.1| photosystem II protein I
[Helianthus divaricatus] gi|559768859|gb|AHB15291.1|
photosystem II protein I [Helianthus decapetalus]
gi|559768945|gb|AHB15376.1| photosystem II protein I
[Helianthus decapetalus] gi|559769031|gb|AHB15461.1|
photosystem II protein I [Helianthus decapetalus]
gi|559769117|gb|AHB15546.1| photosystem II protein I
[Helianthus hirsutus] gi|559769203|gb|AHB15631.1|
photosystem II protein I [Helianthus hirsutus]
gi|559769289|gb|AHB15716.1| photosystem II protein I
[Helianthus tuberosus] gi|559769375|gb|AHB15801.1|
photosystem II protein I [Helianthus tuberosus]
gi|559769461|gb|AHB15886.1| photosystem II protein I
[Helianthus tuberosus] gi|559769547|gb|AHB15971.1|
photosystem II protein I [Helianthus divaricatus]
gi|559769633|gb|AHB16056.1| photosystem II protein I
[Helianthus giganteus] gi|559769719|gb|AHB16141.1|
photosystem II protein I [Helianthus giganteus]
gi|559769805|gb|AHB16226.1| photosystem II protein I
[Helianthus grosseserratus] gi|559769891|gb|AHB16311.1|
photosystem II protein I [Helianthus grosseserratus]
gi|559769977|gb|AHB16396.1| photosystem II protein I
[Helianthus grosseserratus] gi|559770063|gb|AHB16481.1|
photosystem II protein I [Helianthus grosseserratus]
gi|559770149|gb|AHB16566.1| photosystem II protein I
[Helianthus decapetalus] gi|559770235|gb|AHB16651.1|
photosystem II protein I [Helianthus decapetalus]
gi|559770321|gb|AHB16736.1| photosystem II protein I
[Helianthus decapetalus] gi|559770407|gb|AHB16821.1|
photosystem II protein I [Helianthus hirsutus]
gi|559770493|gb|AHB16906.1| photosystem II protein I
[Helianthus hirsutus] gi|559770579|gb|AHB16991.1|
photosystem II protein I [Helianthus strumosus]
gi|559770665|gb|AHB17076.1| photosystem II protein I
[Helianthus tuberosus] gi|559770751|gb|AHB17161.1|
photosystem II protein I [Helianthus tuberosus]
gi|559770837|gb|AHB17246.1| photosystem II protein I
[Helianthus tuberosus] gi|559770923|gb|AHB17331.1|
photosystem II protein I [Helianthus maximiliani]
gi|559771009|gb|AHB17416.1| photosystem II protein I
[Helianthus maximiliani] gi|559771095|gb|AHB17501.1|
photosystem II protein I [Helianthus maximiliani]
gi|559771181|gb|AHB17586.1| photosystem II protein I
[Helianthus maximiliani] gi|563321814|gb|AHB38143.1|
photosystem II protein I (chloroplast) [Macadamia
integrifolia] gi|565666449|emb|CDI73549.1| photosystem
II protein I [Pyrus spinosa] gi|570438043|gb|AHE79755.1|
photosystem II protein I (chloroplast) [Fritillaria
hupehensis] gi|571025788|emb|CCW28163.1| psbI protein
(chloroplast) [Arabis alpina]
gi|571031416|gb|AHF21060.1| photosystem II protein I
[Erodium rupestre] gi|571031492|gb|AHF21135.1|
photosystem II protein I [Erodium manescavi]
gi|573015136|gb|AHF71719.1| photosystem II protein I
(chloroplast) [Nymphaea mexicana]
gi|573015495|gb|AHF72074.1| photosystem II protein I
(chloroplast) [Rosa odorata var. gigantea]
gi|573015585|gb|AHF72163.1| photosystem II protein I
(chloroplast) [Magnolia yunnanensis]
gi|574450345|gb|AHG24530.1| photosystem II protein I
[Erodium reichardii] gi|574450412|gb|AHG24596.1|
photosystem II protein I [Erodium foetidum subsp.
foetidum] gi|576090049|gb|AHH24266.1| photosystem II
protein I (chloroplast) [Japonolirion osense]
gi|576095229|gb|AHH24691.1| photosystem II protein I
[Erodium crassifolium] gi|576597424|gb|AHH29711.1|
photosystem II protein I (chloroplast) [Fritillaria
unibracteata var. wabuensis] gi|576597509|gb|AHH29795.1|
photosystem II protein I (chloroplast) [Fritillaria
cirrhosa] gi|576597594|gb|AHH29879.1| photosystem II
protein I (chloroplast) [Fritillaria taipaiensis]
gi|576598263|gb|AHH30425.1| photosystem II protein I
(chloroplast) [Bartsia inaequalis]
gi|577027678|gb|AHH80568.1| photosystem II protein I
[Erodium gruinum] gi|582041318|gb|AHI43028.1|
photosystem II protein I [Deschampsia antarctica]
gi|584297165|gb|AHI87511.1| photosystem II protein I
(chloroplast) [Chionographis japonica]
gi|586598346|gb|AHJ61129.1| photosystem II protein psbI
protein (chloroplast) [Artemisia montana]
gi|586598433|gb|AHJ61215.1| photosystem II protein psbI
protein (chloroplast) [Sedum takesimense]
gi|586598671|gb|AHJ61371.1| photosystem II protein I
[Cucumis hystrix] gi|586947396|gb|AHJ91193.1|
photosystem II protein I (chloroplast) [Vitis
rotundifolia] gi|586947519|gb|AHJ91302.1| photosystem II
protein I (chloroplast) [Azadirachta indica]
gi|589061037|gb|AHK26858.1| photosystem II protein I
[Prunus mume] gi|595645271|gb|AHM88734.1| photosystem II
protein I (chloroplast) [Lagenaria siceraria]
gi|595645331|gb|AHM88793.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645507|gb|AHM88966.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645566|gb|AHM89024.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645626|gb|AHM89083.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645686|gb|AHM89142.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645746|gb|AHM89201.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645806|gb|AHM89260.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645867|gb|AHM89320.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645927|gb|AHM89379.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595645987|gb|AHM89438.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646047|gb|AHM89497.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646108|gb|AHM89557.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646168|gb|AHM89616.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646228|gb|AHM89675.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646288|gb|AHM89734.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646348|gb|AHM89793.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646408|gb|AHM89852.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646468|gb|AHM89911.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646528|gb|AHM89970.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646588|gb|AHM90029.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646648|gb|AHM90088.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646708|gb|AHM90147.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646768|gb|AHM90206.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646828|gb|AHM90265.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646888|gb|AHM90324.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595646948|gb|AHM90383.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647008|gb|AHM90442.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647068|gb|AHM90501.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647128|gb|AHM90560.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647188|gb|AHM90619.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647248|gb|AHM90678.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647308|gb|AHM90737.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647368|gb|AHM90796.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647428|gb|AHM90855.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647488|gb|AHM90914.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647548|gb|AHM90973.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647608|gb|AHM91032.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647668|gb|AHM91091.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|595647905|gb|AHM91324.1| photosystem II protein I
(chloroplast) [Lagenaria siceraria]
gi|597441128|gb|AHN07154.1| photosystem II protein I
[Cardamine impatiens] gi|597441214|gb|AHN07239.1|
photosystem II protein I [Cardamine resedifolia]
gi|597569090|gb|AHN13521.1| photosystem II protein I
(chloroplast) [Prunus kansuensis]
gi|599088058|gb|AHN52962.1| photosystem II protein I
(chloroplast) [Lonicera japonica]
gi|605059442|gb|AHV90308.1| photosystem II protein I
(chloroplast) [Setaria italica]
gi|608608765|gb|AHW52168.1| photosystem II protein I
(chloroplast) [Rhazya stricta]
gi|618625569|gb|AHX80435.1| photosystem II protein I
[Paris verticillata] gi|618626378|gb|AHX80684.1|
photosystem II protein I (chloroplast) [Hirtella
racemosa] gi|618626462|gb|AHX80767.1| photosystem II
protein I (chloroplast) [Chrysobalanus icaco]
gi|618626546|gb|AHX80850.1| photosystem II protein I
(chloroplast) [Licania heteromorpha]
gi|618626630|gb|AHX80933.1| photosystem II protein I
(chloroplast) [Couepia guianensis]
gi|618626714|gb|AHX81016.1| photosystem II protein I
(chloroplast) [Licania alba] gi|618626798|gb|AHX81099.1|
photosystem II protein I (chloroplast) [Licania sprucei]
gi|618626882|gb|AHX81182.1| photosystem II protein I
(chloroplast) [Hirtella physophora]
gi|618626966|gb|AHX81265.1| photosystem II protein I
(chloroplast) [Parinari campestris]
gi|628819092|gb|AHY80525.1| photosystem II protein I
[Beta vulgaris subsp. vulgaris]
gi|629265449|emb|CCO06413.1| photosystem II protein I
(chloroplast) (chloroplast) [Lecomtella
madagascariensis] gi|629514434|gb|AHY86165.1|
photosystem II protein I [Ampelocalamus calcareus]
gi|631793215|gb|AHZ18115.1| photosystem II protein I
[Dioscorea rotundata] gi|631793301|gb|AHZ18200.1|
photosystem II protein I [Cenchrus americanus]
gi|632812734|gb|AHZ42964.1| photosystem II protein I
(chloroplast) [Cypripedium formosanum]
gi|632812822|gb|AHZ43051.1| photosystem II protein I
(chloroplast) [Goodyera fumata]
gi|634744440|gb|AHZ61363.1| photosystem II protein I
[Bergbambos tessellata] gi|638920716|gb|AIA24311.1|
photosystem II protein I (chloroplast) [Panax
notoginseng] gi|640774539|gb|AIA26338.1| photosystem II
protein I (chloroplast) [Erodium absinthoides]
gi|641803795|gb|AIA76946.1| photosystem II protein I
(chloroplast) (chloroplast) [Capsicum annuum var.
glabriusculum] gi|642988093|gb|AIA81394.1| photosystem
II protein I (chloroplast) [Erodium chrysanthum]
gi|645101137|gb|AIB03738.1| photosystem II protein I
(chloroplast) (chloroplast) [Centaurea diffusa]
gi|648933067|gb|AIC37008.1| photosystem II protein I
(chloroplast) [Salicornia brachiata]
gi|648933152|gb|AIC37092.1| photosystem II protein I
(chloroplast) [Salicornia europaea]
gi|648933237|gb|AIC37176.1| photosystem II protein I
(chloroplast) [Salicornia bigelovii]
gi|648933320|gb|AIC37258.1| photosystem II protein I
[Cypripedium japonicum] gi|655167045|gb|AIC82560.1|
photosystem II protein I (chloroplast) [Habenaria
pantlingiana] gi|655167120|gb|AIC82634.1| photosystem II
protein I (chloroplast) [Paphiopedilum niveum]
gi|657406389|gb|AID52108.1| photosystem II protein I
(chloroplast) [Masdevallia picturata]
gi|657406542|gb|AID52259.1| photosystem II protein I
(chloroplast) [Paphiopedilum armeniacum]
gi|658157534|gb|AID57309.1| photosystem II protein I
(chloroplast) [Gentiana straminea]
gi|659103380|gb|AID60373.1| photosystem II 48-kDa
truncated I protein (chloroplast) [Populus fremontii]
gi|659103528|gb|AID60454.1| photosystem II 48-kDa
truncated I protein (chloroplast) [Populus balsamifera]
gi|659105124|gb|AID61119.1| photosystem II protein I
(chloroplast) [Gentiana crassicaulis]
gi|662020160|gb|AIE42450.1| photosystem II protein I
(chloroplast) [Raphanus sativus]
gi|667669974|gb|AIG61153.1| photosystem II protein I
(chloroplast) [Triticum aestivum]
gi|667670059|gb|AIG61237.1| photosystem II protein I
(chloroplast) [Camellia grandibracteata]
gi|667670147|gb|AIG61324.1| photosystem II protein I
(chloroplast) [Camellia leptophylla]
gi|667670235|gb|AIG61411.1| photosystem II protein I
(chloroplast) [Camellia petelotii]
gi|667670323|gb|AIG61498.1| photosystem II protein I
(chloroplast) [Camellia pubicosta]
gi|667670411|gb|AIG61585.1| photosystem II protein I
(chloroplast) [Camellia reticulata]
gi|667670500|gb|AIG61673.1| photosystem II protein I
(chloroplast) [Camellia sinensis var. dehungensis]
gi|667670588|gb|AIG61760.1| photosystem II protein I
(chloroplast) [Camellia sinensis var. pubilimba]
gi|667670676|gb|AIG61847.1| photosystem II protein I
(chloroplast) [Camellia sinensis var. sinensis]
gi|668349601|gb|AIH00222.1| photosystem II protein I
(chloroplast) [Bambusa multiplex]
gi|668349687|gb|AIH00307.1| photosystem II protein I
(chloroplast) [Phyllostachys sulphurea]
gi|669174703|gb|AII01893.1| photosystem II 48-kDa
truncated I protein (chloroplast) [Salix interior]
gi|672352132|gb|AIJ19577.1| photosystem II protein I
(chloroplast) [Populus euphratica]
gi|673539822|gb|AIK28988.1| photosystem II protein I
(chloroplast) [Brassica napus]
gi|675023048|gb|AIL31721.1| photosystem II protein I
(chloroplast) [Sartidia perrieri]
gi|675023132|gb|AIL31804.1| photosystem II protein I
(chloroplast) [Sartidia dewinteri]
gi|675023142|gb|AIL31813.1| photosystem II protein I
(chloroplast) [Phragmites australis]
gi|675269878|gb|AIL50269.1| photosystem II protein I
(chloroplast) [Citrus aurantiifolia]
gi|684183662|gb|AIM52852.1| photosystem II protein I
[Bambusa bambos] gi|684183746|gb|AIM52936.1| photosystem
II protein I [Bambusa arnhemica]
gi|684183830|gb|AIM53020.1| photosystem II protein I
[Chusquea spectabilis] gi|684183914|gb|AIM53104.1|
photosystem II protein I [Diandrolyra sp. Clark 1301]
gi|684183995|gb|AIM53184.1| photosystem II protein I
[Eremitis sp. Clark & Zhang 1343]
gi|684184160|gb|AIM53348.1| photosystem II protein I
[Hickelia madagascariensis] gi|684184244|gb|AIM53432.1|
photosystem II protein I [Neohouzeaua sp. Clark &
Attigala 1712] gi|684184328|gb|AIM53516.1| photosystem
II protein I [Neololeba atra]
gi|684184412|gb|AIM53600.1| photosystem II protein I
[Olmeca reflexa] gi|684184496|gb|AIM53684.1| photosystem
II protein I [Raddia brasiliensis]
gi|684184666|gb|AIM53852.1| photosystem II protein I
[Buergersiochloa bambusoides]
gi|684184750|gb|AIM53935.1| photosystem II protein I
[Chusquea liebmannii] gi|684184833|gb|AIM54018.1|
photosystem II protein I [Lithachne pauciflora]
gi|684184914|gb|AIM54098.1| photosystem II protein I
[Otatea acuminata] gi|684184998|gb|AIM54182.1|
photosystem II protein I [Pariana radiciflora]
gi|684185079|gb|AIM54262.1| photosystem II protein I
[Thamnocalamus spathiflorus] gi|685161428|gb|AIN79072.1|
photosystem II protein I [Iris gatesii]
gi|690196731|gb|AIR12503.1| photosystem II protein I
[Eustrephus latifolius] gi|690196826|gb|AIR12587.1|
photosystem II protein I [Bomarea edulis]
gi|691192175|gb|AIR76434.1| photosystem II protein I
(chloroplast) [Dendrobium catenatum]
gi|693301833|gb|AIS35667.1| photosystem II protein I
(chloroplast) [Mesembryanthemum crystallinum]
gi|695277399|gb|AIT15976.1| photosystem II protein I
(chloroplast) [Luzuriaga radicans]
gi|699975220|gb|AIU44755.1| photosystem II protein I
(chloroplast) [Phalaenopsis hybrid cultivar]
gi|699975987|gb|AIU45442.1| photosystem II protein I
(chloroplast) [Triticum turgidum subsp. durum]
gi|700744604|gb|AIU98528.1| photosystem II protein I
(chloroplast) [Cynara cardunculus var. scolymus]
gi|700746328|gb|AIU99086.1| photosystem II protein I
(plastid) [Seseli montanum] gi|702075279|gb|AIW05165.1|
photosystem II protein I [Aganosma cymosa]
gi|702075365|gb|AIW05250.1| photosystem II protein I
[Echites umbellatus] gi|702075451|gb|AIW05335.1|
photosystem II protein I [Epigynum auritum]
gi|702075536|gb|AIW05419.1| photosystem II protein I
[Neobracea bahamensis] gi|702075622|gb|AIW05504.1|
photosystem II protein I [Nerium oleander]
gi|702075708|gb|AIW05589.1| photosystem II protein I
[Oncinotis tenuiloba] gi|702075794|gb|AIW05674.1|
photosystem II protein I [Pentalinon luteum]
gi|702075879|gb|AIW05758.1| photosystem II protein I
[Periploca sepium] gi|702075965|gb|AIW05843.1|
photosystem II protein I [Rhabdadenia biflora]
gi|702076051|gb|AIW05928.1| photosystem II protein I
[Wrightia natalensis] gi|704001766|gb|AIW51831.1|
photosystem II protein I (chloroplast) [Lasthenia
burkei] gi|705244206|gb|AIW56401.1| photosystem II
protein I (chloroplast) [Xerophyllum tenax]
gi|705244313|gb|AIW56488.1| photosystem II protein I
(chloroplast) [Heloniopsis tubiflora]
gi|705245188|gb|AIW56821.1| photosystem II protein I
(chloroplast) [Populus trichocarpa]
gi|723005661|gb|AIX11646.1| photosystem II protein I
(chloroplast) [Morus mongolica]
gi|723430223|gb|AIX89727.1| PsbI (chloroplast)
[Fagopyrum tataricum] gi|723604086|gb|AIX97873.1| PsbI
(chloroplast) [Panax ginseng]
gi|723604174|gb|AIX97960.1| PsbI (chloroplast) [Panax
ginseng] gi|723604258|gb|AIX98043.1| PsbI (chloroplast)
[Panax ginseng] gi|723604344|gb|AIX98128.1| PsbI
(chloroplast) [Panax ginseng]
gi|723604430|gb|AIX98213.1| PsbI (chloroplast) [Panax
ginseng] gi|723604516|gb|AIX98298.1| PsbI (chloroplast)
[Panax ginseng] gi|723604602|gb|AIX98383.1| PsbI
(chloroplast) [Panax ginseng]
gi|723604688|gb|AIX98468.1| PsbI (chloroplast) [Panax
ginseng] gi|723604774|gb|AIX98553.1| PsbI (chloroplast)
[Panax ginseng] gi|725798270|emb|CED79746.1| photosystem
II protein I (chloroplast) [Hesperelaea palmeri]
gi|725824027|gb|AIY33806.1| photosystem II protein I
(chloroplast) [Nelumbo nucifera]
gi|727346458|dbj|BAP90864.1| photosystem II protein I
(chloroplast) [Triticum monococcum subsp. monococcum]
gi|729719070|dbj|BAP91053.1| photosystem II protein I
(chloroplast) [Triticum macha]
gi|730042943|gb|AIZ06064.1| photosystem II protein I
(chloroplast) [Brassica napus]
gi|731443620|gb|AIZ57514.1| photosystem II protein I
(chloroplast) [Clematis fusca var. coreana]
gi|743182449|gb|AJC00254.1| photosystem II protein I
[Lysimachia coreana] gi|743403970|emb|CED95145.1| PsbI;
photosystem II protein I (chloroplast) [Acacia ligulata]
gi|744671680|gb|AJC99472.1| PsbI (chloroplast) [Panax
quinquefolius] gi|744671791|gb|AJC99557.1| PsbI
(chloroplast) [Panax ginseng]
gi|744671899|gb|AJC99642.1| PsbI (chloroplast) [Panax
ginseng] gi|744673723|gb|AJD00708.1| photosystem II
protein I [Scrophularia takesimensis]
gi|746001354|dbj|BAQ19625.1| photosystem II protein I
(chloroplast) [Ananas comosus]
gi|748013888|gb|AJE28358.1| photosystem II protein I
(chloroplast) [Premna microphylla]
gi|748990756|gb|AJE71201.1| photosystem II protein I
[Acorus gramineus] gi|751371662|gb|AJF48562.1|
photosystem II protein I (chloroplast) [Salix
suchowensis] gi|755161249|gb|AJJ48501.1| photosystem II
protein I (chloroplast) [Masdevallia coccinea]
gi|755571785|gb|AJK29921.1| photosystem II protein I
(chloroplast) [Dendropanax dentiger]
gi|756141150|gb|AJK90731.1| photosystem II protein I
(chloroplast) [Capsicum lycianthoides]
gi|756142196|gb|AJK91406.1| photosystem II protein I
(chloroplast) [Cannabis sativa]
gi|756761933|gb|AJM70048.1| photosystem II protein I
(chloroplast) [Chloranthus japonicus]
gi|756762301|gb|AJM70392.1| photosystem II protein I
(chloroplast) [Cattleya crispata]
gi|757813329|gb|AJO25094.1| photosystem II protein I
(chloroplast) [Solanum lycopersicum]
gi|757815089|gb|AJO26071.1| photosystem II protein I
(chloroplast) [Actinidia chinensis]
gi|757815173|gb|AJO26154.1| photosystem II protein I
(chloroplast) [Actinidia chinensis]
gi|757815257|gb|AJO26237.1| photosystem II protein I
(chloroplast) [Actinidia deliciosa]
gi|757815341|gb|AJO26320.1| photosystem II protein I
(chloroplast) [Actinidia chinensis]
gi|760173514|gb|AJP09547.1| photosystem II protein I
(chloroplast) [Ipomoea batatas]
gi|765099761|gb|AJR28264.1| photosystem II protein I
(chloroplast) [Salix purpurea]
gi|766544153|gb|AJS14403.1| photosystem II protein I
[Ruellia breedlovei] gi|768801514|gb|AJV86735.1|
photosystem II protein I (chloroplast) [Populus tremula]
gi|768803694|gb|AJV88495.1| photosystem II protein I
(chloroplast) [Campynema lineare]
gi|768803780|gb|AJV88580.1| photosystem II protein I
(chloroplast) [Carludovica palmata]
gi|768803867|gb|AJV88666.1| photosystem II protein I
(chloroplast) [Lilium superbum]
gi|768803972|gb|AJV88763.1| photosystem II protein I
(plastid) [Stipa hymenoides] gi|768804057|gb|AJV88847.1|
photosystem II protein I (plastid) [Ammophila
breviligulata] gi|768804142|gb|AJV88931.1| photosystem
II protein I (plastid) [Ampelodesmos mauritanicus]
gi|768804226|gb|AJV89014.1| photosystem II protein I
(plastid) [Anthoxanthum odoratum]
gi|768804310|gb|AJV89097.1| photosystem II protein I
(plastid) [Avena sativa] gi|768804395|gb|AJV89181.1|
photosystem II protein I (plastid) [Helictochloa
hookeri] gi|768804478|gb|AJV89263.1| photosystem II
protein I (plastid) [Brachyelytrum aristosum]
gi|768804566|gb|AJV89350.1| photosystem II protein I
(plastid) [Briza maxima] gi|768804651|gb|AJV89434.1|
photosystem II protein I (plastid) [Bromus vulgaris]
gi|768804734|gb|AJV89516.1| photosystem II protein I
(plastid) [Dactylis glomerata]
gi|768804819|gb|AJV89600.1| photosystem II protein I
(plastid) [Diarrhena obovata]
gi|768804903|gb|AJV89683.1| photosystem II protein I
(plastid) [Anthoxanthum nitens]
gi|768804988|gb|AJV89767.1| photosystem II protein I
(plastid) [Hordeum jubatum] gi|768805071|gb|AJV89849.1|
photosystem II protein I (plastid) [Melica mutica]
gi|768805155|gb|AJV89932.1| photosystem II protein I
(plastid) [Melica subulata] gi|768805239|gb|AJV90015.1|
photosystem II protein I (plastid) [Oryzopsis
asperifolia] gi|768805324|gb|AJV90099.1| photosystem II
protein I (plastid) [Phaenosperma globosum]
gi|768805408|gb|AJV90182.1| photosystem II protein I
(plastid) [Phalaris arundinacea]
gi|768805493|gb|AJV90266.1| photosystem II protein I
(plastid) [Phleum alpinum] gi|768805578|gb|AJV90350.1|
photosystem II protein I (plastid) [Piptochaetium
avenaceum] gi|768805662|gb|AJV90433.1| photosystem II
protein I (plastid) [Poa palustris]
gi|768805747|gb|AJV90517.1| photosystem II protein I
(plastid) [Puccinellia nuttalliana]
gi|768805832|gb|AJV90601.1| photosystem II protein I
(plastid) [Festuca arundinacea]
gi|768805917|gb|AJV90685.1| photosystem II protein I
(plastid) [Torreyochloa pallida]
gi|768806002|gb|AJV90769.1| photosystem II protein I
(plastid) [Trisetum cernuum] gi|779776202|gb|AJY78676.1|
photosystem II protein I (chloroplast) [Solanum
cheesmaniae] gi|779776291|gb|AJY78759.1| photosystem II
protein I (chloroplast) [Solanum chilense]
gi|779776381|gb|AJY78842.1| photosystem II protein I
(chloroplast) [Solanum galapagense]
gi|779776472|gb|AJY78925.1| photosystem II protein I
(chloroplast) [Solanum habrochaites]
gi|779776562|gb|AJY79008.1| photosystem II protein I
(chloroplast) [Solanum lycopersicum]
gi|779776653|gb|AJY79091.1| photosystem II protein I
(chloroplast) [Solanum neorickii]
gi|779776743|gb|AJY79174.1| photosystem II protein I
(chloroplast) [Solanum peruvianum]
gi|779776833|gb|AJY79257.1| photosystem II protein I
(chloroplast) [Solanum pimpinellifolium]
gi|802085254|gb|AKA94848.1| photosystem II protein I
(chloroplast) [Hibiscus syriacus]
gi|808178173|gb|AKC99505.1| photosystem II protein I
(chloroplast) [Prunus yedoensis]
gi|808178258|gb|AKC99589.1| photosystem II protein I
(chloroplast) [Prunus maximowiczii]
gi|808178343|gb|AKC99673.1| photosystem II protein I
(chloroplast) [Prunus padus] gi|808178428|gb|AKC99757.1|
photosystem II protein I (chloroplast) [Prunus serrulata
var. spontanea] gi|808178513|gb|AKC99841.1| photosystem
II protein I (chloroplast) [Prunus subhirtella var.
subhirtella] gi|808178598|gb|AKC99925.1| photosystem II
protein I (chloroplast) [Prunus subhirtella var.
subhirtella] gi|808178761|gb|AKD00073.1| photosystem II
protein I (plastid) [Brassica napus]
gi|808781947|gb|AKE07326.1| photosystem II protein I
[Guadua weberbaueri] gi|816379430|gb|AKF02062.1|
photosystem II protein I (chloroplast) [Oenocarpus
bataua] gi|816379492|gb|AKF02123.1| photosystem II
protein I (chloroplast) [Oenocarpus minor]
gi|817161699|gb|AKF33681.1| photosystem II protein I
(chloroplast) [Dioscorea zingiberensis]
gi|817161985|gb|AKF33962.1| photosystem II protein I
(chloroplast) [Populus yunnanensis]
gi|817162131|gb|AKF34107.1| photosystem II protein I
(chloroplast) [Morus notabilis]
gi|818214025|gb|AKG26584.1| photosystem II protein I
(chloroplast) [Panax notoginseng]
gi|819231883|gb|AKG49780.1| photosystem II protein I
(chloroplast) [Cynara humilis]
gi|821158486|gb|AKH04415.1| photosystem II protein I
(plastid) [Chusquea circinata]
gi|821158571|gb|AKH04499.1| photosystem II protein I
(plastid) [Chusquea sp. PFM-2015]
gi|821158656|gb|AKH04583.1| photosystem II protein I
(plastid) [Otatea glauca] gi|821158741|gb|AKH04667.1|
photosystem II protein I (plastid) [Pariana campestris]
gi|821158825|gb|AKH04750.1| photosystem II protein I
(plastid) [Pariana radiciflora]
gi|821158909|gb|AKH04833.1| photosystem II protein I
(plastid) [Pariana sp. PFM-2015]
gi|821577429|dbj|BAR79304.1| photosystem II protein I
(chloroplast) [Vigna radiata var. radiata]
gi|821577510|dbj|BAR79384.1| photosystem II protein I
(chloroplast) [Vigna radiata var. sublobata]
gi|821608242|gb|AKH59818.1| photosystem II protein I
(plastid) [Trillium cuneatum]
gi|825715665|gb|AKJ25306.1| photosystem II protein I
(plastid) [Carex siderosticta]
gi|827345210|gb|AKJ76794.1| photosystem II protein I
(chloroplast) [Rosmarinus officinalis]
gi|827346159|gb|AKJ77365.1| photosystem II protein I
(chloroplast) [Elleanthus sodiroi]
gi|827504916|gb|AKJ83502.1| photosystem II protein I
(chloroplast) [Dieffenbachia seguine]
gi|828348664|gb|AKK32125.1| photosystem II protein I
(plastid) [Trillium decumbens]
gi|828348887|gb|AKK32341.1| PSII I protein (chloroplast)
[Cannabis sativa] gi|844169183|gb|AKM97902.1| PsbI
(chloroplast) [Brassica oleracea var. capitata]
gi|844170155|gb|AKM98151.1| photosystem II protein I
(chloroplast) [Anemone patens]
gi|844170278|gb|AKM98239.1| photosystem II protein I
(chloroplast) [Anemone patens]
gi|844170404|gb|AKM98327.1| photosystem II protein I
(chloroplast) [Pulsatilla pratensis]
gi|844170526|gb|AKM98415.1| photosystem II protein I
(chloroplast) [Pulsatilla pratensis]
gi|844170658|gb|AKM98503.1| photosystem II protein I
(chloroplast) [Pulsatilla vernalis]
gi|844170799|gb|AKM98591.1| photosystem II protein I
(chloroplast) [Pulsatilla vernalis]
Length = 36
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 9 YTVVIFFVSLFIFGFLSNDPGRNPGREE 36
>ref|YP_009130823.1| photosystem II protein I (chloroplast) [Gossypium turneri]
gi|384034848|gb|AFH57561.1| photosystem II protein I
(chloroplast) [Gossypium turneri]
Length = 50
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 23 YTVVIFFVSLFIFGFLSNDPGRNPGREE 50
>ref|YP_009129764.1| photosystem II protein I (chloroplast) [Vanilla planifolia]
gi|657406465|gb|AID52183.1| photosystem II protein I
(chloroplast) [Vanilla planifolia]
Length = 51
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 24 YTVVIFFVSLFIFGFLSNDPGRNPGREE 51
>ref|YP_009114853.1| photosystem II protein I [Thalictrum coreanum]
gi|721136289|gb|AIX03500.1| photosystem II protein I
[Thalictrum coreanum]
Length = 52
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 25 YTVVIFFVSLFIFGFLSNDPGRNPGREE 52
>gb|KGN61622.1| hypothetical protein Csa_2G190790 [Cucumis sativus]
Length = 128
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 101 YTVVIFFVSLFIFGFLSNDPGRNPGREE 128
>gb|AGQ50340.1| photosystem II protein I (chloroplast) [Rumex acetosa]
Length = 53
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 26 YTVVIFFVSLFIFGFLSNDPGRNPGREE 53
>emb|CDY71758.1| BnaCnng74310D [Brassica napus]
Length = 80
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 53 YTVVIFFVSLFIFGFLSNDPGRNPGREE 80
>ref|YP_009054820.1| photosystem II protein I (chloroplast) [Triticum timopheevii]
gi|685508433|ref|YP_009057912.1| photosystem II protein
I (chloroplast) [Aegilops longissima]
gi|685508516|ref|YP_009057994.1| photosystem II protein
I (chloroplast) [Aegilops bicornis]
gi|697964662|ref|YP_009057383.1| photosystem II protein
I (chloroplast) [Aegilops sharonensis]
gi|699008301|ref|YP_009057301.1| photosystem II protein
I (chloroplast) [Aegilops searsii]
gi|699008477|ref|YP_009058076.1| photosystem II protein
I (chloroplast) [Aegilops kotschyi]
gi|699018710|ref|YP_009057219.1| photosystem II protein
I (chloroplast) [Triticum turgidum]
gi|667753151|gb|AIG90412.1| photosystem II protein I
(chloroplast) [Triticum aestivum]
gi|667753234|gb|AIG90494.1| photosystem II protein I
(chloroplast) [Triticum turgidum]
gi|667753317|gb|AIG90576.1| photosystem II protein I
(chloroplast) [Triticum turgidum]
gi|667753400|gb|AIG90658.1| photosystem II protein I
(chloroplast) [Triticum turgidum]
gi|667753483|gb|AIG90740.1| photosystem II protein I
(chloroplast) [Triticum turgidum]
gi|667753566|gb|AIG90822.1| photosystem II protein I
(chloroplast) [Triticum turgidum]
gi|667753649|gb|AIG90904.1| photosystem II protein I
(chloroplast) [Triticum turgidum]
gi|667753732|gb|AIG90986.1| photosystem II protein I
(chloroplast) [Triticum aestivum]
gi|667753815|gb|AIG91068.1| photosystem II protein I
(chloroplast) [Aegilops speltoides var. ligustica]
gi|667753898|gb|AIG91150.1| photosystem II protein I
(chloroplast) [Aegilops speltoides var. ligustica]
gi|667753981|gb|AIG91232.1| photosystem II protein I
(chloroplast) [Aegilops speltoides var. speltoides]
gi|667754064|gb|AIG91314.1| photosystem II protein I
(chloroplast) [Triticum timopheevii]
gi|667754147|gb|AIG91396.1| photosystem II protein I
(chloroplast) [Triticum timopheevii]
gi|667754230|gb|AIG91478.1| photosystem II protein I
(chloroplast) [Triticum timopheevii]
gi|667754313|gb|AIG91560.1| photosystem II protein I
(chloroplast) [Triticum timopheevii]
gi|667754396|gb|AIG91642.1| photosystem II protein I
(chloroplast) [Triticum urartu]
gi|667754479|gb|AIG91724.1| photosystem II protein I
(chloroplast) [Aegilops tauschii]
gi|667754562|gb|AIG91806.1| photosystem II protein I
(chloroplast) [Aegilops searsii]
gi|667754645|gb|AIG91888.1| photosystem II protein I
(chloroplast) [Aegilops searsii]
gi|667754728|gb|AIG91970.1| photosystem II protein I
(chloroplast) [Aegilops searsii]
gi|667754811|gb|AIG92052.1| photosystem II protein I
(chloroplast) [Aegilops longissima]
gi|667754894|gb|AIG92134.1| photosystem II protein I
(chloroplast) [Aegilops sharonensis]
gi|667754977|gb|AIG92216.1| photosystem II protein I
(chloroplast) [Aegilops bicornis]
gi|667755060|gb|AIG92298.1| photosystem II protein I
(chloroplast) [Aegilops sharonensis]
gi|667755143|gb|AIG92380.1| photosystem II protein I
(chloroplast) [Aegilops kotschyi]
gi|690966597|dbj|BAP59020.1| photosystem II protein I,
partial (chloroplast) [Triticum timopheevii]
Length = 48
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 21 YTVVIFFVSLFIFGFLSNDPGRNPGREE 48
>ref|YP_009048183.1| photosystem II protein I (chloroplast) [Calanthe triplicata]
gi|573015316|gb|AHF71897.1| photosystem II protein I
(chloroplast) [Calanthe triplicata]
Length = 36
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 9 YTVVIFFVSLFIFGFLSNDPGRNPGREE 36
>ref|YP_009048094.1| photosystem II protein I (chloroplast) [Primula poissonii]
gi|573015217|gb|AHF71799.1| photosystem II protein I
(chloroplast) [Primula poissonii]
Length = 51
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 24 YTVVIFFVSLFIFGFLSNDPGRNPGREE 51
>ref|YP_009045550.1| photosystem II protein I (chloroplast) [Cypripedium macranthos]
gi|578888850|gb|AHI16733.1| photosystem II protein I
(chloroplast) (chloroplast) [Cypripedium macranthos]
Length = 52
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 25 YTVVIFFVSLFIFGFLSNDPGRNPGREE 52
>ref|YP_009041071.1| photosystem II protein I [Rhazya stricta]
gi|645929193|gb|AIB08717.1| photosystem II protein I
[Rhazya stricta]
Length = 52
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 25 YTVVIFFVSLFIFGFLSNDPGRNPGREE 52
>ref|YP_003540915.1| photosystem II protein I [Phoenix dactylifera]
gi|294620561|gb|ADF28131.1| photosystem II protein I
(chloroplast) [Phoenix dactylifera]
Length = 51
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 24 YTVVIFFVSLFIFGFLSNDPGRNPGREE 51
>gb|ADD30672.1| photosystem II protein I (chloroplast) [Meliosma aff. cuneifolia
Moore 333]
Length = 36
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 9 YTVVIFFVSLFIFGFLSNDPGRNPGREE 36
>ref|YP_002720022.1| photosystem II protein I [Nicotiana tabacum]
Length = 51
Score = 60.5 bits (145), Expect = 4e-07
Identities = 27/28 (96%), Positives = 28/28 (100%)
Frame = -2
Query: 442 YTVVIFFVSLFIFGFLSNDPGRNPGRDE 359
YTVVIFFVSLFIFGFLSNDPGRNPGR+E
Sbjct: 24 YTVVIFFVSLFIFGFLSNDPGRNPGREE 51