BLASTX nr result
ID: Cinnamomum23_contig00017690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00017690 (495 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010245555.1| PREDICTED: uncharacterized protein At2g39795... 57 5e-06 >ref|XP_010245555.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Nelumbo nucifera] Length = 246 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 367 QLSRPEAILSEMRKSAFEENILRILRTEIQYQSEYAPLKE 248 Q+ + ++EMRKSAFE NILRILRTEIQY+SEYAP KE Sbjct: 45 QVFQTRNYITEMRKSAFEGNILRILRTEIQYESEYAPSKE 84