BLASTX nr result
ID: Cinnamomum23_contig00017290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00017290 (831 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [... 54 2e-10 gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] 64 1e-07 >emb|CDP57007.1| Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 53.9 bits (128), Expect(2) = 2e-10 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -3 Query: 151 KKFQIFYYISIVISIWVFLLEPYEMKFSYTVLRGG 47 KKFQ FY IS+ + WVFL E YEMKFSYTVL GG Sbjct: 12 KKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGG 46 Score = 39.3 bits (90), Expect(2) = 2e-10 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 51 GESPWFTYLNKVYDWFE 1 G S WFTYLNKVYDWFE Sbjct: 45 GGSSWFTYLNKVYDWFE 61 >gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] Length = 39 Score = 63.9 bits (154), Expect = 1e-07 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 721 MNIRRGRTISVEMTDPFSVLSIGSIITSRTLIFRKYR 831 M IRR +TIS++MTDPFSVLSIGSIITS TLIFRKYR Sbjct: 1 MTIRRDKTISIKMTDPFSVLSIGSIITSHTLIFRKYR 37