BLASTX nr result
ID: Cinnamomum23_contig00016886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00016886 (620 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267122.1| PREDICTED: poly(A) polymerase PAPalpha-like ... 50 6e-08 ref|XP_010267125.1| PREDICTED: poly(A) polymerase beta-like isof... 50 6e-08 >ref|XP_010267122.1| PREDICTED: poly(A) polymerase PAPalpha-like isoform X1 [Nelumbo nucifera] Length = 781 Score = 50.4 bits (119), Expect(2) = 6e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +2 Query: 53 VKPNAALGMVMKVRGEVNSESAQRPVIRLSLTSTA 157 V PN ALGMV+K R NSES +PVIRLSLTSTA Sbjct: 747 VLPNVALGMVLKARSGANSESVSKPVIRLSLTSTA 781 Score = 33.5 bits (75), Expect(2) = 6e-08 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 3 NGCINGSGEFQN*LTEEL 56 NGC+NG+G FQN LTEEL Sbjct: 728 NGCLNGNGIFQNDLTEEL 745 >ref|XP_010267125.1| PREDICTED: poly(A) polymerase beta-like isoform X4 [Nelumbo nucifera] gi|720035715|ref|XP_010267126.1| PREDICTED: poly(A) polymerase beta-like isoform X4 [Nelumbo nucifera] Length = 694 Score = 50.4 bits (119), Expect(2) = 6e-08 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +2 Query: 53 VKPNAALGMVMKVRGEVNSESAQRPVIRLSLTSTA 157 V PN ALGMV+K R NSES +PVIRLSLTSTA Sbjct: 660 VLPNVALGMVLKARSGANSESVSKPVIRLSLTSTA 694 Score = 33.5 bits (75), Expect(2) = 6e-08 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 3 NGCINGSGEFQN*LTEEL 56 NGC+NG+G FQN LTEEL Sbjct: 641 NGCLNGNGIFQNDLTEEL 658