BLASTX nr result
ID: Cinnamomum23_contig00016551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00016551 (285 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369129.1| subtilase family protein [Populus trichocarp... 58 2e-06 ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Popu... 58 3e-06 ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenay... 57 5e-06 ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus... 56 8e-06 >ref|XP_006369129.1| subtilase family protein [Populus trichocarpa] gi|550347490|gb|ERP65698.1| subtilase family protein [Populus trichocarpa] Length = 772 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 152 TSLTHEPQATFIVHVSRSHIPSGVNSHHDWYSSTLRSLPQSPQDRK 15 +S + PQ TFI+HVS+SH PS +SHHDWY+S ++SLP SPQ K Sbjct: 22 SSSSDHPQ-TFIIHVSKSHKPSLFSSHHDWYTSIIQSLPPSPQPAK 66 >ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa] gi|550342556|gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa] Length = 774 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -2 Query: 161 TVHTSLTHEPQATFIVHVSRSHIPSGVNSHHDWYSSTLRSLPQSPQDRK 15 T +S + PQ TFI+HVSRSH PS +SHHDWY+S + SLP SP K Sbjct: 21 TQSSSSSDHPQ-TFIIHVSRSHKPSLFSSHHDWYTSIIHSLPPSPHPAK 68 >ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana] Length = 781 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 152 TSLTHEPQATFIVHVSRSHIPSGVNSHHDWYSSTLRSLPQSPQ 24 TS + QATFIVHVSRS PS +SHH W+SS LRSLP SP+ Sbjct: 26 TSSSDASQATFIVHVSRSQKPSLFSSHHHWHSSILRSLPPSPR 68 >ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica] Length = 774 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -2 Query: 152 TSLTHEPQATFIVHVSRSHIPSGVNSHHDWYSSTLRSLPQSPQDRK 15 +S + + TFI+HVSRSH PS +SHHDWY+S + SLP SP K Sbjct: 23 SSSSSDHPRTFIIHVSRSHKPSLFSSHHDWYTSIIHSLPPSPHPAK 68