BLASTX nr result
ID: Cinnamomum23_contig00016130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00016130 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255205.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_008236735.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-16 ref|XP_007199804.1| hypothetical protein PRUPE_ppa004794mg [Prun... 90 7e-16 ref|XP_010028544.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_010908166.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 emb|CDO97103.1| unnamed protein product [Coffea canephora] 81 3e-13 ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_002519113.1| pentatricopeptide repeat-containing protein,... 80 4e-13 ref|XP_009419044.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 ref|XP_002306075.1| pentatricopeptide repeat-containing family p... 79 2e-12 ref|XP_009375315.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_008459266.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_012064828.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_011457921.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_004145397.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 gb|EPS61672.1| hypothetical protein M569_13122 [Genlisea aurea] 76 1e-11 ref|XP_011037597.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_011037595.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_009345793.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 gb|KHN06157.1| Pentatricopeptide repeat-containing protein [Glyc... 75 2e-11 >ref|XP_010255205.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Nelumbo nucifera] Length = 496 Score = 94.0 bits (232), Expect = 4e-17 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 11/94 (11%) Frame = -2 Query: 251 TLAQTLIQTAIRSHESNGHD-----------LFKTLTKTYRLCDSAPFVFDLLIRACLHT 105 TL++TLI A+R + N D +F+TL KTYR CDSAPFVFDLLIRACL Sbjct: 123 TLSETLIGKAMRLSQVNNIDDSDLSSLRPPKIFETLAKTYRSCDSAPFVFDLLIRACLQA 182 Query: 104 NAIDRAVKIARFLRSRGIYPTAATCNSVIRSAAR 3 ID++++I R LRSR IYP +TCN +I+S +R Sbjct: 183 KKIDQSIEIVRMLRSRQIYPMVSTCNLLIQSVSR 216 >ref|XP_008236735.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Prunus mume] Length = 491 Score = 89.7 bits (221), Expect = 7e-16 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 8/85 (9%) Frame = -2 Query: 245 AQTLIQTAIR--------SHESNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDR 90 A LI+TAIR SHES +F++L KTYR CDSAPFVFDLLI+ACL + ID Sbjct: 123 AYDLIRTAIRVSESESIGSHESEPLKVFESLVKTYRQCDSAPFVFDLLIKACLESKKIDP 182 Query: 89 AVKIARFLRSRGIYPTAATCNSVIR 15 A++I R L SRGI P +TCN++IR Sbjct: 183 AIQIVRMLLSRGISPGLSTCNALIR 207 >ref|XP_007199804.1| hypothetical protein PRUPE_ppa004794mg [Prunus persica] gi|462395204|gb|EMJ01003.1| hypothetical protein PRUPE_ppa004794mg [Prunus persica] Length = 491 Score = 89.7 bits (221), Expect = 7e-16 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 8/85 (9%) Frame = -2 Query: 245 AQTLIQTAIR--------SHESNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDR 90 A LI+TAIR SHES +F++L KTYR CDSAPFVFDLLI+ACL + ID Sbjct: 123 AYDLIRTAIRVSESESIGSHESKPLKVFESLVKTYRQCDSAPFVFDLLIKACLESKKIDP 182 Query: 89 AVKIARFLRSRGIYPTAATCNSVIR 15 A++I R L SRGI P +TCN++IR Sbjct: 183 AIQIVRMLLSRGISPGLSTCNALIR 207 >ref|XP_010028544.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Eucalyptus grandis] gi|629089054|gb|KCW55307.1| hypothetical protein EUGRSUZ_I01233 [Eucalyptus grandis] Length = 485 Score = 83.2 bits (204), Expect = 6e-14 Identities = 44/82 (53%), Positives = 57/82 (69%), Gaps = 1/82 (1%) Frame = -2 Query: 245 AQTLIQTAIR-SHESNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARF 69 AQ LI+ A+R S ++ +F+ L +TYR CDSAPFVFDLLI CL +D A++IAR Sbjct: 123 AQGLIREALRISPDTKPVGVFEVLVRTYRECDSAPFVFDLLIECCLEAKKVDAALEIARL 182 Query: 68 LRSRGIYPTAATCNSVIRSAAR 3 LRSRG+ P AT NS+I S +R Sbjct: 183 LRSRGLSPKVATLNSLICSVSR 204 >ref|XP_010908166.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Elaeis guineensis] Length = 507 Score = 82.0 bits (201), Expect = 1e-13 Identities = 46/94 (48%), Positives = 57/94 (60%), Gaps = 13/94 (13%) Frame = -2 Query: 245 AQTLIQTAIRSHESNGH-------------DLFKTLTKTYRLCDSAPFVFDLLIRACLHT 105 A +L+Q IRSH+ + ++F+ L KTYR DSAPFVFDLLIRA L Sbjct: 134 ALSLLQATIRSHDPSSSSAAAGGVDTCRPPEIFEALAKTYRAFDSAPFVFDLLIRAYLQA 193 Query: 104 NAIDRAVKIARFLRSRGIYPTAATCNSVIRSAAR 3 +DRAV+I R L SRGI P T NS+IRS +R Sbjct: 194 RRLDRAVQIVRILLSRGIQPEIGTSNSLIRSVSR 227 >emb|CDO97103.1| unnamed protein product [Coffea canephora] Length = 507 Score = 80.9 bits (198), Expect = 3e-13 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 4/85 (4%) Frame = -2 Query: 245 AQTLIQTAIRSHE----SNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKI 78 AQ LIQ+AIR S+ +F+TL +TYR+C+SAPFVFDLL++AC+ + I++A +I Sbjct: 140 AQELIQSAIRKFPNPSLSSPPPIFQTLIRTYRICNSAPFVFDLLVKACIESKRIEQATEI 199 Query: 77 ARFLRSRGIYPTAATCNSVIRSAAR 3 R LRS+ I P + CNS+I ++ Sbjct: 200 VRMLRSKKICPNISICNSLIELVSK 224 >ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Vitis vinifera] gi|731383579|ref|XP_010647833.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Vitis vinifera] gi|731383581|ref|XP_010647834.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Vitis vinifera] gi|731383583|ref|XP_010647835.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Vitis vinifera] Length = 492 Score = 80.9 bits (198), Expect = 3e-13 Identities = 40/84 (47%), Positives = 58/84 (69%), Gaps = 6/84 (7%) Frame = -2 Query: 236 LIQTAIRSHESNGH------DLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIA 75 LI+TAIR + + +F++L KTY C SAPFVFDLLI+ACL++ I++++ I Sbjct: 122 LIRTAIRVFDDSDECSSQPPKIFESLVKTYNSCGSAPFVFDLLIKACLNSKRIEQSISIV 181 Query: 74 RFLRSRGIYPTAATCNSVIRSAAR 3 + LRSRGI PT +TCN++I +R Sbjct: 182 KMLRSRGISPTISTCNALIWQVSR 205 >ref|XP_002519113.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541776|gb|EEF43324.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 80.5 bits (197), Expect = 4e-13 Identities = 44/82 (53%), Positives = 54/82 (65%), Gaps = 6/82 (7%) Frame = -2 Query: 245 AQTLIQTAIRS----HESNGHDL--FKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAV 84 AQ++I A S +SNG L F+ L KTYR CDSAPFVFDLLI++CL ID + Sbjct: 121 AQSIIHLAFTSPVLVDDSNGQALKFFEILVKTYRECDSAPFVFDLLIKSCLELKKIDDGL 180 Query: 83 KIARFLRSRGIYPTAATCNSVI 18 KI R LRSRGI P +TCN ++ Sbjct: 181 KIVRLLRSRGISPLISTCNFLV 202 >ref|XP_009419044.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Musa acuminata subsp. malaccensis] Length = 506 Score = 79.3 bits (194), Expect = 9e-13 Identities = 42/93 (45%), Positives = 60/93 (64%), Gaps = 12/93 (12%) Frame = -2 Query: 245 AQTLIQTAIRSHESNGH------------DLFKTLTKTYRLCDSAPFVFDLLIRACLHTN 102 A +L+Q A+RS + + ++F+TL++TY DSAPFVFDLL++A L Sbjct: 133 ALSLLQAAVRSLDPSSSPYTDVEGINGPPEIFRTLSRTYHAFDSAPFVFDLLVQAYLQVK 192 Query: 101 AIDRAVKIARFLRSRGIYPTAATCNSVIRSAAR 3 +DRAV+I R LRSRGI P+ T N++IRS +R Sbjct: 193 RLDRAVQIVRILRSRGIQPSIGTSNALIRSVSR 225 >ref|XP_002306075.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222849039|gb|EEE86586.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 498 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/85 (45%), Positives = 56/85 (65%), Gaps = 4/85 (4%) Frame = -2 Query: 245 AQTLIQTAIRS----HESNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKI 78 AQ +I+ +RS H F+ L K+YR CDSAPFVFDLLI++CL ID +++I Sbjct: 127 AQEIIRAGLRSQILYHLLKEVRFFEVLVKSYRECDSAPFVFDLLIKSCLELKKIDGSIEI 186 Query: 77 ARFLRSRGIYPTAATCNSVIRSAAR 3 + LRS+GI P+ +TCN++I +R Sbjct: 187 VKMLRSKGISPSISTCNALISEVSR 211 >ref|XP_009375315.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Pyrus x bretschneideri] gi|694400451|ref|XP_009375316.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Pyrus x bretschneideri] gi|694400453|ref|XP_009375318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Pyrus x bretschneideri] Length = 488 Score = 77.8 bits (190), Expect = 3e-12 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = -2 Query: 245 AQTLIQTAIR-SHESNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARF 69 A LI+ IR S E+ +F++L KTYR C SAPFVFDLL++ACL + ID +++I R Sbjct: 124 AYDLIRATIRVSDEAEPLKVFESLVKTYRQCGSAPFVFDLLVKACLESKKIDPSIQIVRM 183 Query: 68 LRSRGIYPTAATCNSVIR 15 L SRGI P + CN++IR Sbjct: 184 LLSRGISPGLSICNALIR 201 >ref|XP_008459266.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Cucumis melo] gi|659118719|ref|XP_008459267.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Cucumis melo] Length = 499 Score = 77.4 bits (189), Expect = 3e-12 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 15/93 (16%) Frame = -2 Query: 251 TLAQTLIQTAIRSHESNGHD---------------LFKTLTKTYRLCDSAPFVFDLLIRA 117 T A+ +IQTAIR+ E D LF+TL KTY+ C SAPFVFDLLI+A Sbjct: 123 THAKDVIQTAIRAAELEDSDNYSESERFSSSRPLKLFETLVKTYKRCGSAPFVFDLLIKA 182 Query: 116 CLHTNAIDRAVKIARFLRSRGIYPTAATCNSVI 18 L + +D +++I R LRSRGI P +T NS+I Sbjct: 183 LLDSKKLDSSIEIVRMLRSRGISPQVSTLNSLI 215 >ref|XP_012064828.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Jatropha curcas] gi|643738071|gb|KDP44059.1| hypothetical protein JCGZ_05526 [Jatropha curcas] Length = 479 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/62 (58%), Positives = 44/62 (70%) Frame = -2 Query: 188 FKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARFLRSRGIYPTAATCNSVIRSA 9 F+ L KTYR CDSAPFVFDLLI++CL ID +++I R LRSRGI P TCN +I Sbjct: 146 FEMLLKTYRQCDSAPFVFDLLIKSCLELKKIDGSIEIVRMLRSRGISPQIRTCNLLISCV 205 Query: 8 AR 3 A+ Sbjct: 206 AK 207 >ref|XP_011457921.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Fragaria vesca subsp. vesca] Length = 493 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/60 (58%), Positives = 46/60 (76%) Frame = -2 Query: 194 DLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARFLRSRGIYPTAATCNSVIR 15 ++F+TL KTYR C SAPFVF+ LI+ACL + ID A++I R + SRGI P +TCNS+IR Sbjct: 144 EVFETLVKTYRQCGSAPFVFNYLIKACLESKKIDPAIQIVRMILSRGISPGLSTCNSLIR 203 >ref|XP_004145397.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Cucumis sativus] gi|778669283|ref|XP_011649228.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 [Cucumis sativus] gi|700206656|gb|KGN61775.1| hypothetical protein Csa_2G239400 [Cucumis sativus] Length = 499 Score = 76.3 bits (186), Expect = 8e-12 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 15/93 (16%) Frame = -2 Query: 251 TLAQTLIQTAIRSHESNGHD---------------LFKTLTKTYRLCDSAPFVFDLLIRA 117 T A+ +IQTAIR+ + D LF+TL KTY+ C SAPFVFDLLI+A Sbjct: 123 THAKDVIQTAIRAAQLEDSDNYSKTERFSPSRPLKLFETLVKTYKRCGSAPFVFDLLIKA 182 Query: 116 CLHTNAIDRAVKIARFLRSRGIYPTAATCNSVI 18 L + +D +++I R LRSRGI P +T NS+I Sbjct: 183 LLDSKKLDSSIEIVRMLRSRGISPQVSTLNSLI 215 >gb|EPS61672.1| hypothetical protein M569_13122 [Genlisea aurea] Length = 464 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/82 (42%), Positives = 58/82 (70%), Gaps = 4/82 (4%) Frame = -2 Query: 236 LIQTAIRSHESNGHD----LFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARF 69 +I +A+RSH+ N + + + L K+YR+CDSAPFVFDLL++AC+ + +D A++I Sbjct: 106 VIISAMRSHKDNTNQTPIAILQALIKSYRVCDSAPFVFDLLVKACVDSKKLDSALQIHTL 165 Query: 68 LRSRGIYPTAATCNSVIRSAAR 3 LRS+ ++ +TCNS+I A++ Sbjct: 166 LRSKNVFLKTSTCNSLIELASK 187 >ref|XP_011037597.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 isoform X2 [Populus euphratica] Length = 510 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/62 (53%), Positives = 47/62 (75%) Frame = -2 Query: 188 FKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARFLRSRGIYPTAATCNSVIRSA 9 F+ L K+YR CDSAPFVFDLLI++CL ID +++I + LRS+GI P+ +TCN++I Sbjct: 176 FEVLVKSYRECDSAPFVFDLLIKSCLDLKKIDGSIEIVKMLRSKGISPSISTCNALISEV 235 Query: 8 AR 3 +R Sbjct: 236 SR 237 >ref|XP_011037595.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 isoform X1 [Populus euphratica] gi|743885565|ref|XP_011037596.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980 isoform X1 [Populus euphratica] Length = 524 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/62 (53%), Positives = 47/62 (75%) Frame = -2 Query: 188 FKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARFLRSRGIYPTAATCNSVIRSA 9 F+ L K+YR CDSAPFVFDLLI++CL ID +++I + LRS+GI P+ +TCN++I Sbjct: 176 FEVLVKSYRECDSAPFVFDLLIKSCLDLKKIDGSIEIVKMLRSKGISPSISTCNALISEV 235 Query: 8 AR 3 +R Sbjct: 236 SR 237 >ref|XP_009345793.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Pyrus x bretschneideri] Length = 488 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/78 (50%), Positives = 53/78 (67%), Gaps = 1/78 (1%) Frame = -2 Query: 245 AQTLIQTAIR-SHESNGHDLFKTLTKTYRLCDSAPFVFDLLIRACLHTNAIDRAVKIARF 69 A LI+ IR S E+ +F++L KTYR C SAPFVFDLL++ACL + ID +++I R Sbjct: 124 AYDLIRATIRVSDEAEPLKVFESLVKTYRQCGSAPFVFDLLVKACLESKKIDPSIQIVRM 183 Query: 68 LRSRGIYPTAATCNSVIR 15 L S GI P + CN++IR Sbjct: 184 LLSSGISPGLSICNALIR 201 >gb|KHN06157.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 486 Score = 75.1 bits (183), Expect = 2e-11 Identities = 42/86 (48%), Positives = 54/86 (62%), Gaps = 10/86 (11%) Frame = -2 Query: 245 AQTLIQTAIRSHESNGHD----------LFKTLTKTYRLCDSAPFVFDLLIRACLHTNAI 96 A LI+TAIR+ N + LF+TL KTYR SAPFVFDLLI+ACL + + Sbjct: 116 AYDLIRTAIRASHQNDEENCRFNSRPLNLFETLVKTYRDSGSAPFVFDLLIKACLDSKKL 175 Query: 95 DRAVKIARFLRSRGIYPTAATCNSVI 18 D +++I R L SRGI P +T NS+I Sbjct: 176 DPSIEIVRMLLSRGISPKVSTLNSLI 201