BLASTX nr result
ID: Cinnamomum23_contig00016112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00016112 (2354 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018298.1| AGAMOUS-like 16 [Theobroma cacao] gi|5087236... 59 1e-17 ref|XP_010254615.1| PREDICTED: MADS-box transcription factor 23 ... 57 1e-16 ref|XP_010254616.1| PREDICTED: MADS-box transcription factor 23 ... 57 1e-16 ref|XP_006433768.1| hypothetical protein CICLE_v10003094mg [Citr... 59 1e-16 ref|XP_007223964.1| hypothetical protein PRUPE_ppa014573mg, part... 58 1e-16 ref|XP_008219192.1| PREDICTED: MADS-box transcription factor 23 ... 57 2e-16 ref|XP_010244698.1| PREDICTED: MADS-box transcription factor 23-... 56 2e-16 ref|XP_010244699.1| PREDICTED: MADS-box transcription factor 23-... 56 2e-16 ref|XP_009595408.1| PREDICTED: MADS-box transcription factor 23-... 56 2e-16 ref|XP_009595409.1| PREDICTED: MADS-box transcription factor 23-... 56 2e-16 ref|XP_008219195.1| PREDICTED: agamous-like MADS-box protein AGL... 57 2e-16 ref|XP_010060121.1| PREDICTED: MADS-box transcription factor 23-... 58 3e-16 emb|CBI19301.3| unnamed protein product [Vitis vinifera] 59 3e-16 ref|XP_010060123.1| PREDICTED: MADS-box transcription factor 23-... 58 3e-16 ref|XP_010060125.1| PREDICTED: MADS-box transcription factor 23-... 58 3e-16 gb|KCW66676.1| hypothetical protein EUGRSUZ_F00448 [Eucalyptus g... 58 3e-16 ref|XP_009766319.1| PREDICTED: MADS-box transcription factor 23-... 56 3e-16 ref|XP_009766321.1| PREDICTED: MADS-box transcription factor 23-... 56 3e-16 ref|XP_002527350.1| mads box protein, putative [Ricinus communis... 57 4e-16 ref|XP_008338982.1| PREDICTED: MADS-box transcription factor 23 ... 58 4e-16 >ref|XP_007018298.1| AGAMOUS-like 16 [Theobroma cacao] gi|508723626|gb|EOY15523.1| AGAMOUS-like 16 [Theobroma cacao] Length = 184 Score = 59.3 bits (142), Expect(3) = 1e-17 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE++LEMSLR VRMKK Sbjct: 109 QMMGEELSGLSVKDLQNLESQLEMSLRGVRMKK 141 Score = 54.3 bits (129), Expect(3) = 1e-17 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNLIR+ENMELY+KV Sbjct: 155 KGNLIHQENVELYKKVNLIRQENMELYKKV 184 Score = 26.2 bits (56), Expect(3) = 1e-17 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE+NRK Sbjct: 141 KDQILMDEIQELNRK 155 Score = 48.1 bits (113), Expect(3) = 8e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 1736 HGQLIGEELSGLSVEDL*TLESKLDISSRGARIKK 1632 H Q++GEELSGLSV+DL LES+L++S RG R+KK Sbjct: 107 HRQMMGEELSGLSVKDLQNLESQLEMSLRGVRMKK 141 Score = 27.7 bits (60), Expect(3) = 8e-06 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 7/29 (24%) Frame = -1 Query: 1418 GNIIH*ENMELY-------*EKMELYLKI 1353 GN+IH EN+ELY E MELY K+ Sbjct: 156 GNLIHQENVELYKKVNLIRQENMELYKKV 184 Score = 23.1 bits (48), Expect(3) = 8e-06 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 1551 DQLLIDEIHELN 1516 DQ+L+DEI ELN Sbjct: 142 DQILMDEIQELN 153 >ref|XP_010254615.1| PREDICTED: MADS-box transcription factor 23 isoform X1 [Nelumbo nucifera] Length = 240 Score = 57.0 bits (136), Expect(3) = 1e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 QLMGEELSGL+VKDLQNLE +LEMSLR VRM+K Sbjct: 109 QLMGEELSGLTVKDLQNLENQLEMSLRCVRMRK 141 Score = 54.3 bits (129), Expect(3) = 1e-16 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR+EN+ELY+KV Sbjct: 155 KGNLIHQENMELYKKVNLIRQENIELYKKV 184 Score = 25.0 bits (53), Expect(3) = 1e-16 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L EIQE+NRK Sbjct: 141 KDQILTDEIQELNRK 155 >ref|XP_010254616.1| PREDICTED: MADS-box transcription factor 23 isoform X2 [Nelumbo nucifera] Length = 239 Score = 57.0 bits (136), Expect(3) = 1e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 QLMGEELSGL+VKDLQNLE +LEMSLR VRM+K Sbjct: 109 QLMGEELSGLTVKDLQNLENQLEMSLRCVRMRK 141 Score = 54.3 bits (129), Expect(3) = 1e-16 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR+EN+ELY+KV Sbjct: 155 KGNLIHQENMELYKKVNLIRQENIELYKKV 184 Score = 25.0 bits (53), Expect(3) = 1e-16 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L EIQE+NRK Sbjct: 141 KDQILTDEIQELNRK 155 >ref|XP_006433768.1| hypothetical protein CICLE_v10003094mg [Citrus clementina] gi|557535890|gb|ESR47008.1| hypothetical protein CICLE_v10003094mg [Citrus clementina] Length = 176 Score = 58.9 bits (141), Expect(3) = 1e-16 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMSLR VRMKK Sbjct: 48 QMMGEELSGLSVKDLQNLENQLEMSLRGVRMKK 80 Score = 53.1 bits (126), Expect(3) = 1e-16 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNLIR+ENMELY KV Sbjct: 94 KGNLIHQENVELYKKVNLIRQENMELYTKV 123 Score = 24.3 bits (51), Expect(3) = 1e-16 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE++RK Sbjct: 80 KDQILMDEIQELSRK 94 >ref|XP_007223964.1| hypothetical protein PRUPE_ppa014573mg, partial [Prunus persica] gi|462420900|gb|EMJ25163.1| hypothetical protein PRUPE_ppa014573mg, partial [Prunus persica] Length = 131 Score = 58.2 bits (139), Expect(3) = 1e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMS+R VRMKK Sbjct: 1 QMMGEELSGLSVKDLQNLENQLEMSIRGVRMKK 33 Score = 51.2 bits (121), Expect(3) = 1e-16 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNL R++NMELY+KV Sbjct: 47 KGNLIHQENVELYKKVNLTRQQNMELYKKV 76 Score = 26.9 bits (58), Expect(3) = 1e-16 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL+ EIQE+NRK Sbjct: 33 KDQLLMDEIQELNRK 47 >ref|XP_008219192.1| PREDICTED: MADS-box transcription factor 23 isoform X1 [Prunus mume] Length = 239 Score = 56.6 bits (135), Expect(3) = 2e-16 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMSLR VR KK Sbjct: 109 QMMGEELSGLSVKDLQNLENQLEMSLRGVRTKK 141 Score = 52.4 bits (124), Expect(3) = 2e-16 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNL R+ENMELY+KV Sbjct: 155 KGNLIHQENVELYKKVNLTRQENMELYKKV 184 Score = 26.9 bits (58), Expect(3) = 2e-16 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL+ EIQE+NRK Sbjct: 141 KDQLLMDEIQELNRK 155 >ref|XP_010244698.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Nelumbo nucifera] Length = 239 Score = 55.8 bits (133), Expect(3) = 2e-16 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR+ENMELY+KV Sbjct: 154 KGNLIHQENMELYKKVNLIRQENMELYKKV 183 Score = 54.3 bits (129), Expect(3) = 2e-16 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 QLMGE+LSGL+VKDLQ+LE +LEMSLR VRM+K Sbjct: 108 QLMGEQLSGLTVKDLQHLENQLEMSLRGVRMRK 140 Score = 25.8 bits (55), Expect(3) = 2e-16 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL EIQE+NRK Sbjct: 140 KDQLLTDEIQELNRK 154 >ref|XP_010244699.1| PREDICTED: MADS-box transcription factor 23-like isoform X2 [Nelumbo nucifera] Length = 238 Score = 55.8 bits (133), Expect(3) = 2e-16 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR+ENMELY+KV Sbjct: 154 KGNLIHQENMELYKKVNLIRQENMELYKKV 183 Score = 54.3 bits (129), Expect(3) = 2e-16 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 QLMGE+LSGL+VKDLQ+LE +LEMSLR VRM+K Sbjct: 108 QLMGEQLSGLTVKDLQHLENQLEMSLRGVRMRK 140 Score = 25.8 bits (55), Expect(3) = 2e-16 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL EIQE+NRK Sbjct: 140 KDQLLTDEIQELNRK 154 >ref|XP_009595408.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Nicotiana tomentosiformis] Length = 238 Score = 55.8 bits (133), Expect(3) = 2e-16 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR+ENMELY+KV Sbjct: 155 KGNLIHQENMELYKKVNLIRQENMELYKKV 184 Score = 55.1 bits (131), Expect(3) = 2e-16 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGE+LSGLSVKDLQNLE +LEMSLR VR++K Sbjct: 109 QMMGEQLSGLSVKDLQNLENQLEMSLRGVRVRK 141 Score = 25.0 bits (53), Expect(3) = 2e-16 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +D++L+ EIQE+NRK Sbjct: 141 KDEILIDEIQELNRK 155 >ref|XP_009595409.1| PREDICTED: MADS-box transcription factor 23-like isoform X2 [Nicotiana tomentosiformis] Length = 236 Score = 55.8 bits (133), Expect(3) = 2e-16 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR+ENMELY+KV Sbjct: 153 KGNLIHQENMELYKKVNLIRQENMELYKKV 182 Score = 55.1 bits (131), Expect(3) = 2e-16 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGE+LSGLSVKDLQNLE +LEMSLR VR++K Sbjct: 107 QMMGEQLSGLSVKDLQNLENQLEMSLRGVRVRK 139 Score = 25.0 bits (53), Expect(3) = 2e-16 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +D++L+ EIQE+NRK Sbjct: 139 KDEILIDEIQELNRK 153 >ref|XP_008219195.1| PREDICTED: agamous-like MADS-box protein AGL16 isoform X4 [Prunus mume] Length = 187 Score = 56.6 bits (135), Expect(3) = 2e-16 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMSLR VR KK Sbjct: 57 QMMGEELSGLSVKDLQNLENQLEMSLRGVRTKK 89 Score = 52.4 bits (124), Expect(3) = 2e-16 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNL R+ENMELY+KV Sbjct: 103 KGNLIHQENVELYKKVNLTRQENMELYKKV 132 Score = 26.9 bits (58), Expect(3) = 2e-16 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL+ EIQE+NRK Sbjct: 89 KDQLLMDEIQELNRK 103 >ref|XP_010060121.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Eucalyptus grandis] gi|702362293|ref|XP_010060122.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Eucalyptus grandis] Length = 297 Score = 57.8 bits (138), Expect(3) = 3e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGL+VKDLQNLE +LEMSLR VRMKK Sbjct: 109 QMMGEELSGLTVKDLQNLENQLEMSLRGVRMKK 141 Score = 51.2 bits (121), Expect(3) = 3e-16 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +G++IHQEN++L KKVNLIR+ENMELY+KV Sbjct: 155 KGSLIHQENVDLYKKVNLIRQENMELYKKV 184 Score = 26.2 bits (56), Expect(3) = 3e-16 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE+NRK Sbjct: 141 KDQILMDEIQELNRK 155 >emb|CBI19301.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 58.9 bits (141), Expect(3) = 3e-16 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMSLR VRMKK Sbjct: 109 QMMGEELSGLSVKDLQNLENQLEMSLRGVRMKK 141 Score = 51.6 bits (122), Expect(3) = 3e-16 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN++H EN+EL KKVNLIR+ENMELY+KV Sbjct: 155 KGNLLHNENVELYKKVNLIRQENMELYKKV 184 Score = 24.6 bits (52), Expect(3) = 3e-16 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE+N+K Sbjct: 141 KDQILIDEIQELNQK 155 >ref|XP_010060123.1| PREDICTED: MADS-box transcription factor 23-like isoform X2 [Eucalyptus grandis] Length = 239 Score = 57.8 bits (138), Expect(3) = 3e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGL+VKDLQNLE +LEMSLR VRMKK Sbjct: 109 QMMGEELSGLTVKDLQNLENQLEMSLRGVRMKK 141 Score = 51.2 bits (121), Expect(3) = 3e-16 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +G++IHQEN++L KKVNLIR+ENMELY+KV Sbjct: 155 KGSLIHQENVDLYKKVNLIRQENMELYKKV 184 Score = 26.2 bits (56), Expect(3) = 3e-16 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE+NRK Sbjct: 141 KDQILMDEIQELNRK 155 >ref|XP_010060125.1| PREDICTED: MADS-box transcription factor 23-like isoform X3 [Eucalyptus grandis] Length = 238 Score = 57.8 bits (138), Expect(3) = 3e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGL+VKDLQNLE +LEMSLR VRMKK Sbjct: 109 QMMGEELSGLTVKDLQNLENQLEMSLRGVRMKK 141 Score = 51.2 bits (121), Expect(3) = 3e-16 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +G++IHQEN++L KKVNLIR+ENMELY+KV Sbjct: 155 KGSLIHQENVDLYKKVNLIRQENMELYKKV 184 Score = 26.2 bits (56), Expect(3) = 3e-16 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE+NRK Sbjct: 141 KDQILMDEIQELNRK 155 >gb|KCW66676.1| hypothetical protein EUGRSUZ_F00448 [Eucalyptus grandis] Length = 177 Score = 57.8 bits (138), Expect(3) = 3e-16 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGL+VKDLQNLE +LEMSLR VRMKK Sbjct: 48 QMMGEELSGLTVKDLQNLENQLEMSLRGVRMKK 80 Score = 51.2 bits (121), Expect(3) = 3e-16 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +G++IHQEN++L KKVNLIR+ENMELY+KV Sbjct: 94 KGSLIHQENVDLYKKVNLIRQENMELYKKV 123 Score = 26.2 bits (56), Expect(3) = 3e-16 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQ+L+ EIQE+NRK Sbjct: 80 KDQILMDEIQELNRK 94 >ref|XP_009766319.1| PREDICTED: MADS-box transcription factor 23-like isoform X1 [Nicotiana sylvestris] Length = 259 Score = 56.2 bits (134), Expect(3) = 3e-16 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMSLR VR++K Sbjct: 130 QMMGEELSGLSVKDLQNLENQLEMSLRGVRVRK 162 Score = 53.5 bits (127), Expect(3) = 3e-16 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR++NMELY++V Sbjct: 176 KGNLIHQENMELYKKVNLIRQQNMELYKRV 205 Score = 25.0 bits (53), Expect(3) = 3e-16 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +D++L+ EIQE+NRK Sbjct: 162 KDEILIDEIQELNRK 176 >ref|XP_009766321.1| PREDICTED: MADS-box transcription factor 23-like isoform X3 [Nicotiana sylvestris] Length = 238 Score = 56.2 bits (134), Expect(3) = 3e-16 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLSVKDLQNLE +LEMSLR VR++K Sbjct: 109 QMMGEELSGLSVKDLQNLENQLEMSLRGVRVRK 141 Score = 53.5 bits (127), Expect(3) = 3e-16 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQENMEL KKVNLIR++NMELY++V Sbjct: 155 KGNLIHQENMELYKKVNLIRQQNMELYKRV 184 Score = 25.0 bits (53), Expect(3) = 3e-16 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +D++L+ EIQE+NRK Sbjct: 141 KDEILIDEIQELNRK 155 >ref|XP_002527350.1| mads box protein, putative [Ricinus communis] gi|223533269|gb|EEF35022.1| mads box protein, putative [Ricinus communis] Length = 262 Score = 56.6 bits (135), Expect(3) = 4e-16 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGLS+K+LQNLE +LEMSLR VRMKK Sbjct: 109 QMMGEELSGLSIKELQNLEGRLEMSLRGVRMKK 141 Score = 52.0 bits (123), Expect(3) = 4e-16 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNLIR+EN ELY+KV Sbjct: 155 KGNLIHQENVELYKKVNLIRQENTELYKKV 184 Score = 25.8 bits (55), Expect(3) = 4e-16 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL+ EI+E+NRK Sbjct: 141 KDQLLMDEIEELNRK 155 >ref|XP_008338982.1| PREDICTED: MADS-box transcription factor 23 isoform X1 [Malus domestica] gi|658007605|ref|XP_008338983.1| PREDICTED: MADS-box transcription factor 23 isoform X1 [Malus domestica] gi|658007607|ref|XP_008338984.1| PREDICTED: MADS-box transcription factor 23 isoform X1 [Malus domestica] Length = 240 Score = 57.8 bits (138), Expect(3) = 4e-16 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 QLMGEELSGLSVKDLQNLETKLEMSLRSVRMKK 101 Q+MGEELSGL+VKDLQNLE +LEMSLRSVR+KK Sbjct: 109 QMMGEELSGLNVKDLQNLENQLEMSLRSVRIKK 141 Score = 50.8 bits (120), Expect(3) = 4e-16 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 314 QGNIIHQENMELNKKVNLIREENMELYRKV 403 +GN+IHQEN+EL KKVNLIR+ENMEL +KV Sbjct: 155 KGNLIHQENIELYKKVNLIRQENMELSKKV 184 Score = 25.8 bits (55), Expect(3) = 4e-16 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 184 QDQLLLSEIQEVNRK 228 +DQLL+ EI+E+NRK Sbjct: 141 KDQLLMDEIEELNRK 155