BLASTX nr result
ID: Cinnamomum23_contig00015564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00015564 (759 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS62068.1| DNA-directed RNA polymerase subunit alpha [Tritic... 52 9e-09 >gb|EMS62068.1| DNA-directed RNA polymerase subunit alpha [Triticum urartu] Length = 430 Score = 52.4 bits (124), Expect(2) = 9e-09 Identities = 30/52 (57%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = +3 Query: 159 MTLCKKRFTGFNFTGL--QLPIARNSVLTSKCSIPK*ASKFDHDQMLFGWSH 308 MTL KK F F+F L QL I N +L KCSI K A KFDHDQ+L G SH Sbjct: 377 MTLGKKSFIRFSFPKLHLQLLIENNPILMGKCSISKWAYKFDHDQLLCGLSH 428 Score = 35.0 bits (79), Expect(2) = 9e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +2 Query: 50 IHPPKEPDMIIFYHPA 97 IHPPKEPDM I++HPA Sbjct: 339 IHPPKEPDMRIYHHPA 354