BLASTX nr result
ID: Cinnamomum23_contig00014864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00014864 (223 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_662849.1| hypothetical protein AN5245.2 [Aspergillus nidu... 51 4e-09 >ref|XP_662849.1| hypothetical protein AN5245.2 [Aspergillus nidulans FGSC A4] gi|40742997|gb|EAA62187.1| predicted protein [Aspergillus nidulans FGSC A4] gi|259484709|tpe|CBF81163.1| TPA: hypothetical protein ANIA_05245 [Aspergillus nidulans FGSC A4] Length = 198 Score = 50.8 bits (120), Expect(2) = 4e-09 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -3 Query: 116 KPIRIRLRCAGEKSSLSGTDSDLEAFSHNPTHGSFAPL 3 +PIRI+LR AG S SGTDSDLEAFSH P GS A L Sbjct: 143 RPIRIQLRRAGATSPRSGTDSDLEAFSHYPADGSVAAL 180 Score = 36.6 bits (83), Expect(2) = 4e-09 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = -2 Query: 222 VCKGFIPAQSEIAIRRLEGMRFCVPSVAGLLRFEA 118 VC+GFIPA+ +IAIR+ F +VA LLR+ A Sbjct: 107 VCRGFIPARGDIAIRQPAPEGFSPGAVASLLRYRA 141