BLASTX nr result
ID: Cinnamomum23_contig00014450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00014450 (369 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012089311.1| PREDICTED: pentatricopeptide repeat-containi... 119 8e-25 ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, par... 119 8e-25 ref|XP_010694775.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_008445200.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_011624530.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 gb|KHN33926.1| Pentatricopeptide repeat-containing protein [Glyc... 117 3e-24 ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 ref|XP_012490790.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_003557645.2| PREDICTED: pentatricopeptide repeat-containi... 116 5e-24 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 116 5e-24 ref|XP_012843423.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 ref|XP_010048219.1| PREDICTED: pentatricopeptide repeat-containi... 116 7e-24 gb|KCW80405.1| hypothetical protein EUGRSUZ_C01762, partial [Euc... 116 7e-24 gb|EYU32342.1| hypothetical protein MIMGU_mgv1a019145mg [Erythra... 116 7e-24 ref|XP_010052946.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 gb|KCW77096.1| hypothetical protein EUGRSUZ_D01436 [Eucalyptus g... 115 1e-23 ref|XP_010922370.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_010243351.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_008219679.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 >ref|XP_012089311.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial-like [Jatropha curcas] gi|643708783|gb|KDP23699.1| hypothetical protein JCGZ_23532 [Jatropha curcas] Length = 808 Score = 119 bits (298), Expect = 8e-25 Identities = 51/64 (79%), Positives = 57/64 (89%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 A+AFGLI T PG P+RVVKNLR+CDDCH+A KL+SK+Y R IVVRDRNRFHHF GGLCSC Sbjct: 745 AMAFGLISTAPGIPIRVVKNLRICDDCHTATKLLSKVYGRIIVVRDRNRFHHFSGGLCSC 804 Query: 187 GDYW 176 GDYW Sbjct: 805 GDYW 808 >ref|XP_007161217.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] gi|561034681|gb|ESW33211.1| hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] Length = 380 Score = 119 bits (298), Expect = 8e-25 Identities = 49/64 (76%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL+ T PGTP+R+VKNLRVC+DCHSA K +SK+Y R+IVVRDRNRFHHF+ GLCSC Sbjct: 317 AIAFGLLSTPPGTPIRIVKNLRVCEDCHSATKFISKVYSREIVVRDRNRFHHFKNGLCSC 376 Query: 187 GDYW 176 GD+W Sbjct: 377 GDFW 380 >ref|XP_010694775.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870845375|gb|KMS98114.1| hypothetical protein BVRB_4g095600 [Beta vulgaris subsp. vulgaris] Length = 803 Score = 118 bits (295), Expect = 2e-24 Identities = 51/64 (79%), Positives = 57/64 (89%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 A+AFGLI T PGTP+R+VKNLRVCDDCH+A KL+SKIY+R IVVRDRNRFHHF G CSC Sbjct: 740 AMAFGLISTAPGTPIRIVKNLRVCDDCHTATKLLSKIYNRKIVVRDRNRFHHFSKGSCSC 799 Query: 187 GDYW 176 GDYW Sbjct: 800 GDYW 803 >ref|XP_008445200.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis melo] gi|659088862|ref|XP_008445201.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis melo] Length = 606 Score = 117 bits (294), Expect = 2e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL++T PGTP+R+VKNLRVC DCHSA K +SKIYDR+I++RDRNRFHHF+ G CSC Sbjct: 543 AIAFGLLRTPPGTPIRIVKNLRVCSDCHSASKFISKIYDREIIMRDRNRFHHFKSGQCSC 602 Query: 187 GDYW 176 GD+W Sbjct: 603 GDFW 606 >ref|XP_004138859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] gi|700207823|gb|KGN62942.1| hypothetical protein Csa_2G381680 [Cucumis sativus] Length = 606 Score = 117 bits (294), Expect = 2e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL++T PGTP+R+VKNLRVC DCHSA K +SKIYDR+I++RDRNRFHHF+ G CSC Sbjct: 543 AIAFGLLRTPPGTPIRIVKNLRVCSDCHSASKFISKIYDREIIMRDRNRFHHFKSGQCSC 602 Query: 187 GDYW 176 GD+W Sbjct: 603 GDFW 606 >ref|XP_011624530.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Amborella trichopoda] Length = 623 Score = 117 bits (293), Expect = 3e-24 Identities = 51/64 (79%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGLI T PGT LR+VKNLRVC+DCHSA+KL+SKIY R+I+VRDRNRFHHF+ G CSC Sbjct: 560 AIAFGLINTDPGTLLRIVKNLRVCEDCHSAVKLISKIYAREIIVRDRNRFHHFRQGNCSC 619 Query: 187 GDYW 176 GDYW Sbjct: 620 GDYW 623 >gb|KHN33926.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 402 Score = 117 bits (293), Expect = 3e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L+ T PGTP+R+VKNLRVC+DCHSA K +SK+Y+R+IVVRDRNRFHHF+ GLCSC Sbjct: 339 AIAFALLSTPPGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSC 398 Query: 187 GDYW 176 GD+W Sbjct: 399 GDFW 402 >ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Glycine max] gi|571538394|ref|XP_006601144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Glycine max] gi|571538398|ref|XP_006601145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X3 [Glycine max] gi|571538402|ref|XP_006601146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X4 [Glycine max] Length = 615 Score = 117 bits (293), Expect = 3e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L+ T PGTP+R+VKNLRVC+DCHSA K +SK+Y+R+IVVRDRNRFHHF+ GLCSC Sbjct: 552 AIAFALLSTPPGTPIRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSC 611 Query: 187 GDYW 176 GD+W Sbjct: 612 GDFW 615 >ref|XP_012490790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 [Gossypium raimondii] gi|763775303|gb|KJB42426.1| hypothetical protein B456_007G152300 [Gossypium raimondii] Length = 644 Score = 117 bits (292), Expect = 4e-24 Identities = 51/64 (79%), Positives = 56/64 (87%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGLI T PGTPL +VKNLRVCDDCHS IKL+SKIY R+I+VRDR RFHHF+ GLCSC Sbjct: 581 AIAFGLISTNPGTPLGIVKNLRVCDDCHSWIKLISKIYKREIIVRDRRRFHHFENGLCSC 640 Query: 187 GDYW 176 DYW Sbjct: 641 KDYW 644 >ref|XP_003557645.2| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Brachypodium distachyon] Length = 602 Score = 116 bits (291), Expect = 5e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L+K+ PGTP+R+VKNLRVC DCH AIKL+SK+YDR+I+VRDR+RFHHF+GG CSC Sbjct: 539 AIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKVYDREIIVRDRSRFHHFKGGACSC 598 Query: 187 GDYW 176 DYW Sbjct: 599 KDYW 602 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Setaria italica] Length = 594 Score = 116 bits (291), Expect = 5e-24 Identities = 49/64 (76%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L+K+ PGTP+R+VKNLRVC DCH AIKL+SKIYDR+I+VRDR+RFHHF+GG CSC Sbjct: 531 AIAFALLKSLPGTPIRIVKNLRVCGDCHMAIKLISKIYDREIIVRDRSRFHHFKGGSCSC 590 Query: 187 GDYW 176 DYW Sbjct: 591 KDYW 594 >ref|XP_012843423.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Erythranthe guttatus] Length = 592 Score = 116 bits (290), Expect = 7e-24 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL+KT+PG+ +R+VKNLRVCDDCHSA KL+S IY RDIVVRDRNRFHHF+ GLCSC Sbjct: 529 AIAFGLMKTSPGSTIRIVKNLRVCDDCHSATKLISVIYKRDIVVRDRNRFHHFKDGLCSC 588 Query: 187 GDYW 176 D+W Sbjct: 589 NDFW 592 >ref|XP_010048219.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Eucalyptus grandis] Length = 614 Score = 116 bits (290), Expect = 7e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L++T PGT +R+VKNLRVC+DCHSA K +SKIYDR+IVVRDRNRFHHF+ G+CSC Sbjct: 551 AIAFALLRTPPGTSIRIVKNLRVCEDCHSATKFISKIYDREIVVRDRNRFHHFKDGMCSC 610 Query: 187 GDYW 176 GD+W Sbjct: 611 GDFW 614 >gb|KCW80405.1| hypothetical protein EUGRSUZ_C01762, partial [Eucalyptus grandis] Length = 576 Score = 116 bits (290), Expect = 7e-24 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L++T PGT +R+VKNLRVC+DCHSA K +SKIYDR+IVVRDRNRFHHF+ G+CSC Sbjct: 513 AIAFALLRTPPGTSIRIVKNLRVCEDCHSATKFISKIYDREIVVRDRNRFHHFKDGMCSC 572 Query: 187 GDYW 176 GD+W Sbjct: 573 GDFW 576 >gb|EYU32342.1| hypothetical protein MIMGU_mgv1a019145mg [Erythranthe guttata] Length = 486 Score = 116 bits (290), Expect = 7e-24 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL+KT+PG+ +R+VKNLRVCDDCHSA KL+S IY RDIVVRDRNRFHHF+ GLCSC Sbjct: 423 AIAFGLMKTSPGSTIRIVKNLRVCDDCHSATKLISVIYKRDIVVRDRNRFHHFKDGLCSC 482 Query: 187 GDYW 176 D+W Sbjct: 483 NDFW 486 >ref|XP_010052946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Eucalyptus grandis] Length = 444 Score = 115 bits (288), Expect = 1e-23 Identities = 48/64 (75%), Positives = 56/64 (87%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL+ T P TPLR+VKNLR+CDDCH IKL+SKIYDR+I+VRDRNRFHHF GG C+C Sbjct: 381 AIAFGLVSTNPRTPLRIVKNLRICDDCHLVIKLISKIYDREIIVRDRNRFHHFLGGSCTC 440 Query: 187 GDYW 176 +YW Sbjct: 441 KEYW 444 >gb|KCW77096.1| hypothetical protein EUGRSUZ_D01436 [Eucalyptus grandis] Length = 565 Score = 115 bits (288), Expect = 1e-23 Identities = 48/64 (75%), Positives = 56/64 (87%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGL+ T P TPLR+VKNLR+CDDCH IKL+SKIYDR+I+VRDRNRFHHF GG C+C Sbjct: 502 AIAFGLVSTNPRTPLRIVKNLRICDDCHLVIKLISKIYDREIIVRDRNRFHHFLGGSCTC 561 Query: 187 GDYW 176 +YW Sbjct: 562 KEYW 565 >ref|XP_010922370.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Elaeis guineensis] Length = 593 Score = 115 bits (287), Expect = 1e-23 Identities = 49/64 (76%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 A+AFGLI+T PGT LRVVKNLRVC DCH+A+KL+S+IY R+IV+RDRNRFHHF+ G CSC Sbjct: 530 AVAFGLIRTVPGTTLRVVKNLRVCADCHAAMKLISEIYGREIVLRDRNRFHHFKSGSCSC 589 Query: 187 GDYW 176 GDYW Sbjct: 590 GDYW 593 >ref|XP_010243351.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 [Nelumbo nucifera] Length = 670 Score = 115 bits (287), Expect = 1e-23 Identities = 49/64 (76%), Positives = 58/64 (90%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAFGLI T+PGT LR+VKNLR+C DCHS+IKL+SKIY+R +VVRDRNRFHHF+ GLCSC Sbjct: 607 AIAFGLISTSPGTTLRIVKNLRICGDCHSSIKLISKIYNRRVVVRDRNRFHHFENGLCSC 666 Query: 187 GDYW 176 D+W Sbjct: 667 MDFW 670 >ref|XP_008219679.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Prunus mume] Length = 606 Score = 115 bits (287), Expect = 1e-23 Identities = 48/64 (75%), Positives = 57/64 (89%) Frame = -3 Query: 367 AIAFGLIKTTPGTPLRVVKNLRVCDDCHSAIKLVSKIYDRDIVVRDRNRFHHFQGGLCSC 188 AIAF L+ T PGTP+R+VKNLRVCDDCHSA K +SKIY+R+IVVRDRNRFHHF+ G+CSC Sbjct: 543 AIAFALLNTPPGTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSC 602 Query: 187 GDYW 176 D+W Sbjct: 603 RDFW 606