BLASTX nr result
ID: Cinnamomum23_contig00014338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00014338 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525457.1| leucine-rich repeat containing protein, puta... 60 7e-07 gb|KHG28874.1| Putative disease resistance RGA3 [Gossypium arbor... 59 2e-06 ref|XP_007018346.1| Nbs-lrr resistance protein, putative [Theobr... 57 4e-06 >ref|XP_002525457.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223535270|gb|EEF36947.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1177 Score = 59.7 bits (143), Expect = 7e-07 Identities = 35/74 (47%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Frame = -1 Query: 219 PKLANLPR-LPSIERLWLAKNNERLLRSLADLTSLKSLSIQEFAKLESIEDGLLQNLSHL 43 PKL N+PR L S+E L L+ +NE LLR L LTSL +L I EF+++ S+E ++NL++L Sbjct: 861 PKLRNMPRNLSSLEELELSDSNEMLLRVLPSLTSLATLRISEFSEVISLERE-VENLTNL 919 Query: 42 SRLTISRCPELIYL 1 L I C +L++L Sbjct: 920 KSLHIKMCDKLVFL 933 >gb|KHG28874.1| Putative disease resistance RGA3 [Gossypium arboreum] Length = 1204 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/73 (45%), Positives = 46/73 (63%) Frame = -1 Query: 219 PKLANLPRLPSIERLWLAKNNERLLRSLADLTSLKSLSIQEFAKLESIEDGLLQNLSHLS 40 P+L NLP+ PS++ L L +E LLRSL +++SL L I F + D LLQN +L Sbjct: 873 PRLLNLPQFPSVKHLELRNCHEALLRSLVNVSSLCILVIDVFTGQLVLLDTLLQNNVNLM 932 Query: 39 RLTISRCPELIYL 1 LTIS CP++ Y+ Sbjct: 933 SLTISSCPKIRYI 945 >ref|XP_007018346.1| Nbs-lrr resistance protein, putative [Theobroma cacao] gi|508723674|gb|EOY15571.1| Nbs-lrr resistance protein, putative [Theobroma cacao] Length = 1179 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/70 (45%), Positives = 42/70 (60%) Frame = -1 Query: 219 PKLANLPRLPSIERLWLAKNNERLLRSLADLTSLKSLSIQEFAKLESIEDGLLQNLSHLS 40 P+L N+P+L S+ L L +E +LRS ++TSL L I F + D LLQN HL Sbjct: 879 PRLMNMPQLSSLRHLDLQNCHETILRSAVNVTSLSVLIISVFTGQLIVLDNLLQNNVHLM 938 Query: 39 RLTISRCPEL 10 LTIS CP+L Sbjct: 939 SLTISSCPKL 948