BLASTX nr result
ID: Cinnamomum23_contig00014207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00014207 (1334 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 67 3e-08 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 67.0 bits (162), Expect = 3e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 AWKARGYSRRRFIIFNVSNSKPNMKFWFHSAPLW 102 AWKA+GYSRRRF +VSNSKPNMK WFHSAPLW Sbjct: 23 AWKAKGYSRRRFSSLSVSNSKPNMKLWFHSAPLW 56