BLASTX nr result
ID: Cinnamomum23_contig00013382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00013382 (479 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009380149.1| PREDICTED: polypyrimidine tract-binding prot... 109 8e-22 ref|XP_009380148.1| PREDICTED: polypyrimidine tract-binding prot... 109 8e-22 emb|CRL16784.1| Polypyrimidine tract-binding protein [Rhododendr... 108 1e-21 ref|XP_012474519.1| PREDICTED: polypyrimidine tract-binding prot... 106 5e-21 gb|KJB23814.1| hypothetical protein B456_004G115700 [Gossypium r... 106 5e-21 gb|KJB23813.1| hypothetical protein B456_004G115700 [Gossypium r... 106 5e-21 ref|XP_012474518.1| PREDICTED: polypyrimidine tract-binding prot... 106 5e-21 gb|KJB23811.1| hypothetical protein B456_004G115700 [Gossypium r... 106 5e-21 gb|KJB23810.1| hypothetical protein B456_004G115700 [Gossypium r... 106 5e-21 ref|XP_012474515.1| PREDICTED: polypyrimidine tract-binding prot... 106 5e-21 ref|XP_012090107.1| PREDICTED: polypyrimidine tract-binding prot... 106 5e-21 ref|XP_002513582.1| polypyrimidine tract binding protein, putati... 106 5e-21 ref|XP_010097853.1| Polypyrimidine tract-binding protein-2-like ... 106 7e-21 ref|XP_012852230.1| PREDICTED: polypyrimidine tract-binding prot... 106 7e-21 ref|XP_012440023.1| PREDICTED: polypyrimidine tract-binding prot... 106 7e-21 gb|KJB33527.1| hypothetical protein B456_006G014900 [Gossypium r... 106 7e-21 ref|XP_012483578.1| PREDICTED: polypyrimidine tract-binding prot... 106 7e-21 gb|KJB33525.1| hypothetical protein B456_006G014900 [Gossypium r... 106 7e-21 gb|KJB33524.1| hypothetical protein B456_006G014900 [Gossypium r... 106 7e-21 gb|KJB33523.1| hypothetical protein B456_006G014900 [Gossypium r... 106 7e-21 >ref|XP_009380149.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 315 Score = 109 bits (272), Expect = 8e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAFVEF Sbjct: 11 RYTQTPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFVEF 62 >ref|XP_009380148.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 459 Score = 109 bits (272), Expect = 8e-22 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAFVEF Sbjct: 11 RYTQTPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFVEF 62 >emb|CRL16784.1| Polypyrimidine tract-binding protein [Rhododendron simsii] Length = 436 Score = 108 bits (270), Expect = 1e-21 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEEL+ELGKPFGK+VNTKCNVGANRNQAF+EF Sbjct: 11 RYTQTPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEF 62 >ref|XP_012474519.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like isoform X3 [Gossypium raimondii] Length = 447 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >gb|KJB23814.1| hypothetical protein B456_004G115700 [Gossypium raimondii] Length = 300 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >gb|KJB23813.1| hypothetical protein B456_004G115700 [Gossypium raimondii] Length = 340 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >ref|XP_012474518.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like isoform X2 [Gossypium raimondii] gi|763756481|gb|KJB23812.1| hypothetical protein B456_004G115700 [Gossypium raimondii] Length = 448 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >gb|KJB23811.1| hypothetical protein B456_004G115700 [Gossypium raimondii] Length = 317 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >gb|KJB23810.1| hypothetical protein B456_004G115700 [Gossypium raimondii] Length = 267 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >ref|XP_012474515.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like isoform X1 [Gossypium raimondii] gi|823149300|ref|XP_012474516.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like isoform X1 [Gossypium raimondii] gi|823149302|ref|XP_012474517.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like isoform X1 [Gossypium raimondii] gi|763756478|gb|KJB23809.1| hypothetical protein B456_004G115700 [Gossypium raimondii] gi|763756484|gb|KJB23815.1| hypothetical protein B456_004G115700 [Gossypium raimondii] Length = 452 Score = 106 bits (265), Expect = 5e-21 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGKIVNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKIVNTKCNVGANRNQAFIEF 62 >ref|XP_012090107.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform X1 [Jatropha curcas] gi|802766871|ref|XP_012090108.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform X1 [Jatropha curcas] gi|643706034|gb|KDP22166.1| hypothetical protein JCGZ_25997 [Jatropha curcas] Length = 449 Score = 106 bits (265), Expect = 5e-21 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGK+VNTKCNVGANRNQAF+EF Sbjct: 11 RLTQPPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEF 62 >ref|XP_002513582.1| polypyrimidine tract binding protein, putative [Ricinus communis] gi|223547490|gb|EEF48985.1| polypyrimidine tract binding protein, putative [Ricinus communis] Length = 447 Score = 106 bits (265), Expect = 5e-21 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGK+VNTKCNVGANRNQAF+EF Sbjct: 11 RLTQPPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEF 62 >ref|XP_010097853.1| Polypyrimidine tract-binding protein-2-like protein [Morus notabilis] gi|587883533|gb|EXB72450.1| Polypyrimidine tract-binding protein-2-like protein [Morus notabilis] Length = 444 Score = 106 bits (264), Expect = 7e-21 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGK+VNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEF 62 >ref|XP_012852230.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Erythranthe guttatus] Length = 421 Score = 106 bits (264), Expect = 7e-21 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVE 475 R TQTPSKVLHLRNLPWECTEEEL+ELGKPFGK+VNTKCNVGANRNQAF+E Sbjct: 11 RYTQTPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIE 61 >ref|XP_012440023.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Gossypium raimondii] gi|823214541|ref|XP_012440024.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Gossypium raimondii] gi|763785545|gb|KJB52616.1| hypothetical protein B456_008G270300 [Gossypium raimondii] gi|763785546|gb|KJB52617.1| hypothetical protein B456_008G270300 [Gossypium raimondii] Length = 437 Score = 106 bits (264), Expect = 7e-21 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQ PSKVLHLRNLPWECTEEEL+ELGKPFGK+VNTKCNVGANRNQAF+EF Sbjct: 11 RYTQPPSKVLHLRNLPWECTEEELIELGKPFGKVVNTKCNVGANRNQAFIEF 62 >gb|KJB33527.1| hypothetical protein B456_006G014900 [Gossypium raimondii] Length = 316 Score = 106 bits (264), Expect = 7e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEELVEL KPFGKIVNTKCNVGANRNQAFVEF Sbjct: 10 RYTQTPSKVLHLRNLPWECTEEELVELCKPFGKIVNTKCNVGANRNQAFVEF 61 >ref|XP_012483578.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like isoform X1 [Gossypium raimondii] gi|823167263|ref|XP_012483579.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like isoform X1 [Gossypium raimondii] gi|763766311|gb|KJB33526.1| hypothetical protein B456_006G014900 [Gossypium raimondii] Length = 461 Score = 106 bits (264), Expect = 7e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEELVEL KPFGKIVNTKCNVGANRNQAFVEF Sbjct: 10 RYTQTPSKVLHLRNLPWECTEEELVELCKPFGKIVNTKCNVGANRNQAFVEF 61 >gb|KJB33525.1| hypothetical protein B456_006G014900 [Gossypium raimondii] Length = 315 Score = 106 bits (264), Expect = 7e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEELVEL KPFGKIVNTKCNVGANRNQAFVEF Sbjct: 10 RYTQTPSKVLHLRNLPWECTEEELVELCKPFGKIVNTKCNVGANRNQAFVEF 61 >gb|KJB33524.1| hypothetical protein B456_006G014900 [Gossypium raimondii] Length = 436 Score = 106 bits (264), Expect = 7e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEELVEL KPFGKIVNTKCNVGANRNQAFVEF Sbjct: 10 RYTQTPSKVLHLRNLPWECTEEELVELCKPFGKIVNTKCNVGANRNQAFVEF 61 >gb|KJB33523.1| hypothetical protein B456_006G014900 [Gossypium raimondii] Length = 434 Score = 106 bits (264), Expect = 7e-21 Identities = 50/52 (96%), Positives = 50/52 (96%) Frame = +2 Query: 323 RCTQTPSKVLHLRNLPWECTEEELVELGKPFGKIVNTKCNVGANRNQAFVEF 478 R TQTPSKVLHLRNLPWECTEEELVEL KPFGKIVNTKCNVGANRNQAFVEF Sbjct: 10 RYTQTPSKVLHLRNLPWECTEEELVELCKPFGKIVNTKCNVGANRNQAFVEF 61