BLASTX nr result
ID: Cinnamomum23_contig00013267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00013267 (469 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039003.1| RING/U-box superfamily protein, putative [Th... 58 2e-06 >ref|XP_007039003.1| RING/U-box superfamily protein, putative [Theobroma cacao] gi|508776248|gb|EOY23504.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 374 Score = 58.2 bits (139), Expect = 2e-06 Identities = 45/136 (33%), Positives = 59/136 (43%) Frame = +2 Query: 32 TLFNCSKIVDFDYYFGSYIHIPCLSDSEHDAFVDSSEDMDSGYTVGKLRVSCQTTKTISV 211 T FNCS DY + I CLS + F SS + V L SCQ T++V Sbjct: 126 TFFNCS----LDYLKYGFNPIACLSGGNYTVFATSSTKV-----VSSLSSSCQRVTTVAV 176 Query: 212 PRLYPFNLNWSSTTPPSSEDHMYLMSRWLSNYYSFDQDLHDLMWYVPGCIGCEQRGGMEC 391 P + W+S H ++ LSN L W P C CE RGG EC Sbjct: 177 P------VEWAS--------HDQILKSDLSNNLR-------LTWDKPKCRKCESRGG-EC 214 Query: 392 RYKDDNSNDTLCSPSP 439 R K +++ T+CS +P Sbjct: 215 RLKANSTRQTICSNAP 230