BLASTX nr result
ID: Cinnamomum23_contig00013068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00013068 (476 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008810897.1| PREDICTED: GDP-mannose transporter GONST1 [P... 100 5e-19 ref|XP_008813043.1| PREDICTED: GDP-mannose transporter GONST1-li... 99 1e-18 ref|XP_008813042.1| PREDICTED: GDP-mannose transporter GONST1-li... 99 1e-18 ref|XP_010911580.1| PREDICTED: GDP-mannose transporter GONST1 [E... 97 3e-18 gb|KHN09612.1| GDP-mannose transporter GONST1 [Glycine soja] 97 4e-18 ref|XP_009399237.1| PREDICTED: GDP-mannose transporter GONST1-li... 97 4e-18 ref|XP_009399226.1| PREDICTED: GDP-mannose transporter GONST1-li... 97 4e-18 ref|XP_009399219.1| PREDICTED: GDP-mannose transporter GONST1-li... 97 4e-18 ref|XP_010025595.1| PREDICTED: GDP-mannose transporter GONST1 is... 96 9e-18 ref|XP_010025596.1| PREDICTED: GDP-mannose transporter GONST1 is... 96 9e-18 ref|XP_003522487.2| PREDICTED: GDP-mannose transporter GONST1-li... 96 9e-18 ref|XP_007137727.1| hypothetical protein PHAVU_009G150800g [Phas... 96 9e-18 gb|KDO50306.1| hypothetical protein CISIN_1g022936mg [Citrus sin... 96 1e-17 gb|KDO50305.1| hypothetical protein CISIN_1g022936mg [Citrus sin... 96 1e-17 gb|KDO50303.1| hypothetical protein CISIN_1g022936mg [Citrus sin... 96 1e-17 ref|XP_006582513.1| PREDICTED: GDP-mannose transporter GONST1-li... 96 1e-17 ref|XP_006432217.1| hypothetical protein CICLE_v10001354mg [Citr... 96 1e-17 ref|XP_011628553.1| PREDICTED: GDP-mannose transporter GONST1 [A... 95 2e-17 gb|ERN19864.1| hypothetical protein AMTR_s00071p00025870 [Ambore... 95 2e-17 ref|XP_010270391.1| PREDICTED: GDP-mannose transporter GONST1 is... 94 3e-17 >ref|XP_008810897.1| PREDICTED: GDP-mannose transporter GONST1 [Phoenix dactylifera] Length = 346 Score = 100 bits (248), Expect = 5e-19 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN +SILFGLLAG+FFAKAKM ERS Sbjct: 289 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENFISILFGLLAGIFFAKAKMRERS 344 >ref|XP_008813043.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Phoenix dactylifera] Length = 346 Score = 98.6 bits (244), Expect = 1e-18 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV T+LEN +SILFGLLAGVFFAKAKM ERS Sbjct: 289 TGATTYSLVGSLNKIPLSIAGILLFKVPTTLENFLSILFGLLAGVFFAKAKMRERS 344 >ref|XP_008813042.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Phoenix dactylifera] Length = 407 Score = 98.6 bits (244), Expect = 1e-18 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV T+LEN +SILFGLLAGVFFAKAKM ERS Sbjct: 350 TGATTYSLVGSLNKIPLSIAGILLFKVPTTLENFLSILFGLLAGVFFAKAKMRERS 405 >ref|XP_010911580.1| PREDICTED: GDP-mannose transporter GONST1 [Elaeis guineensis] Length = 346 Score = 97.4 bits (241), Expect = 3e-18 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGI+LFKV TSLEN +SILFGLLAGVFFAKAK+ ERS Sbjct: 289 TGATTYSLVGSLNKIPLSVAGIVLFKVPTSLENFISILFGLLAGVFFAKAKIRERS 344 >gb|KHN09612.1| GDP-mannose transporter GONST1 [Glycine soja] Length = 340 Score = 97.1 bits (240), Expect = 4e-18 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN SILFGLLAGVFFA+AK++ERS Sbjct: 283 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKILERS 338 >ref|XP_009399237.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 330 Score = 97.1 bits (240), Expect = 4e-18 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN +SILFGLLAGVFFAKAK+ +RS Sbjct: 273 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSLSILFGLLAGVFFAKAKLQDRS 328 >ref|XP_009399226.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 346 Score = 97.1 bits (240), Expect = 4e-18 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN +SILFGLLAGVFFAKAK+ +RS Sbjct: 289 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSLSILFGLLAGVFFAKAKLQDRS 344 >ref|XP_009399219.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 407 Score = 97.1 bits (240), Expect = 4e-18 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN +SILFGLLAGVFFAKAK+ +RS Sbjct: 350 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSLSILFGLLAGVFFAKAKLQDRS 405 >ref|XP_010025595.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Eucalyptus grandis] Length = 351 Score = 95.9 bits (237), Expect = 9e-18 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 296 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 351 >ref|XP_010025596.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Eucalyptus grandis] gi|702450873|ref|XP_010025597.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Eucalyptus grandis] gi|629096322|gb|KCW62317.1| hypothetical protein EUGRSUZ_H04965 [Eucalyptus grandis] Length = 336 Score = 95.9 bits (237), Expect = 9e-18 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 281 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 336 >ref|XP_003522487.2| PREDICTED: GDP-mannose transporter GONST1-like [Glycine max] gi|734400061|gb|KHN31147.1| GDP-mannose transporter GONST1 [Glycine soja] Length = 342 Score = 95.9 bits (237), Expect = 9e-18 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 285 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 340 >ref|XP_007137727.1| hypothetical protein PHAVU_009G150800g [Phaseolus vulgaris] gi|561010814|gb|ESW09721.1| hypothetical protein PHAVU_009G150800g [Phaseolus vulgaris] Length = 337 Score = 95.9 bits (237), Expect = 9e-18 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN SILFGLLAGVFFA+AK+ ERS Sbjct: 280 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKIRERS 335 >gb|KDO50306.1| hypothetical protein CISIN_1g022936mg [Citrus sinensis] Length = 226 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGILLFKV TSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 168 TGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 223 >gb|KDO50305.1| hypothetical protein CISIN_1g022936mg [Citrus sinensis] Length = 223 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGILLFKV TSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 165 TGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 220 >gb|KDO50303.1| hypothetical protein CISIN_1g022936mg [Citrus sinensis] Length = 290 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGILLFKV TSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 232 TGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 287 >ref|XP_006582513.1| PREDICTED: GDP-mannose transporter GONST1-like [Glycine max] Length = 475 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMER 310 TGATTYSLVGSLNKIPLSIAGILLFKV TSLEN SILFGLLAGVFFA+AK++ER Sbjct: 285 TGATTYSLVGSLNKIPLSIAGILLFKVPTSLENSASILFGLLAGVFFARAKILER 339 >ref|XP_006432217.1| hypothetical protein CICLE_v10001354mg [Citrus clementina] gi|568821008|ref|XP_006464990.1| PREDICTED: GDP-mannose transporter GONST1-like [Citrus sinensis] gi|557534339|gb|ESR45457.1| hypothetical protein CICLE_v10001354mg [Citrus clementina] Length = 404 Score = 95.5 bits (236), Expect = 1e-17 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGILLFKV TSLEN SI FGLLAGVFFA+AKM ERS Sbjct: 346 TGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERS 401 >ref|XP_011628553.1| PREDICTED: GDP-mannose transporter GONST1 [Amborella trichopoda] gi|769794834|ref|XP_011628554.1| PREDICTED: GDP-mannose transporter GONST1 [Amborella trichopoda] gi|769794836|ref|XP_011628555.1| PREDICTED: GDP-mannose transporter GONST1 [Amborella trichopoda] Length = 346 Score = 94.7 bits (234), Expect = 2e-17 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGILLF V TSL+N +SILFGLLAGVFFA+AKM+ERS Sbjct: 289 TGATTYSLVGSLNKIPLSMAGILLFHVPTSLKNFLSILFGLLAGVFFARAKMLERS 344 >gb|ERN19864.1| hypothetical protein AMTR_s00071p00025870 [Amborella trichopoda] Length = 344 Score = 94.7 bits (234), Expect = 2e-17 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLS+AGILLF V TSL+N +SILFGLLAGVFFA+AKM+ERS Sbjct: 287 TGATTYSLVGSLNKIPLSMAGILLFHVPTSLKNFLSILFGLLAGVFFARAKMLERS 342 >ref|XP_010270391.1| PREDICTED: GDP-mannose transporter GONST1 isoform X3 [Nelumbo nucifera] Length = 330 Score = 94.4 bits (233), Expect = 3e-17 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = -3 Query: 474 TGATTYSLVGSLNKIPLSIAGILLFKVSTSLENLVSILFGLLAGVFFAKAKMMERS 307 TGATTYSLVGSLNKIPLSIAGILLF V TSLEN SILFGLLAGVFFA+AKM E+S Sbjct: 273 TGATTYSLVGSLNKIPLSIAGILLFSVPTSLENFSSILFGLLAGVFFARAKMWEKS 328