BLASTX nr result
ID: Cinnamomum23_contig00012551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00012551 (273 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008221340.1| PREDICTED: zinc transporter 6, chloroplastic... 63 9e-08 ref|XP_010257099.1| PREDICTED: zinc transporter 6, chloroplastic... 62 1e-07 ref|XP_010043412.1| PREDICTED: zinc transporter 6, chloroplastic... 62 1e-07 ref|XP_002881083.1| zinc transporter ZIP6 [Arabidopsis lyrata su... 62 1e-07 ref|XP_010321288.1| PREDICTED: ZIP5 isoform X1 [Solanum lycopers... 62 2e-07 ref|XP_007205467.1| hypothetical protein PRUPE_ppa007995mg [Prun... 62 2e-07 ref|NP_001238802.1| ZIP5 [Solanum lycopersicum] gi|311088597|gb|... 62 2e-07 ref|XP_011024923.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 ref|XP_011003820.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 ref|XP_010414318.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 ref|XP_010510413.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 emb|CDP09221.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_002299993.1| Zinc transporter 6 family protein [Populus t... 61 3e-07 ref|XP_002313244.2| Zinc transporter 6 family protein [Populus t... 61 3e-07 ref|XP_006294530.1| hypothetical protein CARUB_v10023566mg [Caps... 61 3e-07 ref|NP_180569.1| Zinc transporter 6 [Arabidopsis thaliana] gi|37... 61 3e-07 ref|XP_012476459.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 gb|KHG06136.1| Zinc transporter 6, chloroplastic -like protein [... 61 3e-07 ref|XP_009369589.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 ref|XP_009354015.1| PREDICTED: zinc transporter 6, chloroplastic... 61 3e-07 >ref|XP_008221340.1| PREDICTED: zinc transporter 6, chloroplastic [Prunus mume] Length = 349 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVTLGMSQN+CTIK Sbjct: 191 RLVSQVLEIGIIFHSVIIGVTLGMSQNQCTIK 222 >ref|XP_010257099.1| PREDICTED: zinc transporter 6, chloroplastic [Nelumbo nucifera] Length = 339 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGIVFHSVIIGVTLGMSQN+CTI+ Sbjct: 181 RLVSQVLEIGIVFHSVIIGVTLGMSQNQCTIR 212 >ref|XP_010043412.1| PREDICTED: zinc transporter 6, chloroplastic [Eucalyptus grandis] gi|629120924|gb|KCW85414.1| hypothetical protein EUGRSUZ_B02234 [Eucalyptus grandis] Length = 332 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTIK Sbjct: 173 RLVSQVLEIGIIFHSVIIGVTMGMSQNQCTIK 204 >ref|XP_002881083.1| zinc transporter ZIP6 [Arabidopsis lyrata subsp. lyrata] gi|297326922|gb|EFH57342.1| zinc transporter ZIP6 [Arabidopsis lyrata subsp. lyrata] Length = 335 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVTLGMSQN+CTI+ Sbjct: 173 RLVSQVLEIGIIFHSVIIGVTLGMSQNKCTIR 204 >ref|XP_010321288.1| PREDICTED: ZIP5 isoform X1 [Solanum lycopersicum] Length = 328 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVTLGMSQN+CTI+ Sbjct: 170 RLVSQVLEIGIIFHSVIIGVTLGMSQNQCTIR 201 >ref|XP_007205467.1| hypothetical protein PRUPE_ppa007995mg [Prunus persica] gi|462401109|gb|EMJ06666.1| hypothetical protein PRUPE_ppa007995mg [Prunus persica] Length = 349 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVTLGMSQN+CTI+ Sbjct: 191 RLVSQVLEIGIIFHSVIIGVTLGMSQNQCTIR 222 >ref|NP_001238802.1| ZIP5 [Solanum lycopersicum] gi|311088597|gb|ADP68586.1| ZIP5 [Solanum lycopersicum] Length = 328 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVTLGMSQN+CTI+ Sbjct: 170 RLVSQVLEIGIIFHSVIIGVTLGMSQNQCTIR 201 >ref|XP_011024923.1| PREDICTED: zinc transporter 6, chloroplastic-like [Populus euphratica] Length = 345 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 187 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 218 >ref|XP_011003820.1| PREDICTED: zinc transporter 6, chloroplastic [Populus euphratica] Length = 337 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 179 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 210 >ref|XP_010414318.1| PREDICTED: zinc transporter 6, chloroplastic-like [Camelina sativa] Length = 341 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 179 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 210 >ref|XP_010510413.1| PREDICTED: zinc transporter 6, chloroplastic-like [Camelina sativa] Length = 342 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 180 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 211 >emb|CDP09221.1| unnamed protein product [Coffea canephora] Length = 345 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 187 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 218 >ref|XP_002299993.1| Zinc transporter 6 family protein [Populus trichocarpa] gi|222847251|gb|EEE84798.1| Zinc transporter 6 family protein [Populus trichocarpa] Length = 337 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 179 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 210 >ref|XP_002313244.2| Zinc transporter 6 family protein [Populus trichocarpa] gi|550331257|gb|EEE87199.2| Zinc transporter 6 family protein [Populus trichocarpa] Length = 335 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 177 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 208 >ref|XP_006294530.1| hypothetical protein CARUB_v10023566mg [Capsella rubella] gi|482563238|gb|EOA27428.1| hypothetical protein CARUB_v10023566mg [Capsella rubella] Length = 341 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 179 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 210 >ref|NP_180569.1| Zinc transporter 6 [Arabidopsis thaliana] gi|37090161|sp|O64738.1|ZIP6_ARATH RecName: Full=Zinc transporter 6, chloroplastic; AltName: Full=ZRT/IRT-like protein 6; Flags: Precursor gi|17385786|gb|AAL38433.1|AF369910_1 putative metal transporter ZIP6 [Arabidopsis thaliana] gi|3150412|gb|AAC16964.1| putative Fe(II) transport protein [Arabidopsis thaliana] gi|20197229|gb|AAM14983.1| putative Fe(II) transport protein [Arabidopsis thaliana] gi|330253248|gb|AEC08342.1| ZIP metal ion transporter family [Arabidopsis thaliana] Length = 341 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 179 RLVSQVLEIGIIFHSVIIGVTMGMSQNKCTIR 210 >ref|XP_012476459.1| PREDICTED: zinc transporter 6, chloroplastic-like [Gossypium raimondii] gi|763758914|gb|KJB26245.1| hypothetical protein B456_004G232700 [Gossypium raimondii] Length = 325 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 167 RLVSQVLEIGIIFHSVIIGVTMGMSQNQCTIR 198 >gb|KHG06136.1| Zinc transporter 6, chloroplastic -like protein [Gossypium arboreum] Length = 325 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 167 RLVSQVLEIGIIFHSVIIGVTMGMSQNQCTIR 198 >ref|XP_009369589.1| PREDICTED: zinc transporter 6, chloroplastic-like [Pyrus x bretschneideri] gi|694387702|ref|XP_009369590.1| PREDICTED: zinc transporter 6, chloroplastic-like [Pyrus x bretschneideri] gi|694422262|ref|XP_009338959.1| PREDICTED: zinc transporter 6, chloroplastic-like [Pyrus x bretschneideri] gi|694422265|ref|XP_009338960.1| PREDICTED: zinc transporter 6, chloroplastic-like [Pyrus x bretschneideri] Length = 352 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 194 RLVSQVLEIGIIFHSVIIGVTMGMSQNQCTIR 225 >ref|XP_009354015.1| PREDICTED: zinc transporter 6, chloroplastic-like [Pyrus x bretschneideri] Length = 350 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 273 RLVSQVLEIGIVFHSVIIGVTLGMSQNRCTIK 178 RLVSQVLEIGI+FHSVIIGVT+GMSQN+CTI+ Sbjct: 192 RLVSQVLEIGIIFHSVIIGVTMGMSQNQCTIR 223