BLASTX nr result
ID: Cinnamomum23_contig00011986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00011986 (1650 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU03482.1| somatic embryogenesis receptor-like kinase [Theob... 65 2e-07 ref|XP_007020221.1| Somatic embryogenesis receptor-like kinase 1... 65 2e-07 ref|XP_007020220.1| Somatic embryogenesis receptor-like kinase 2... 65 2e-07 ref|XP_009377456.1| PREDICTED: uncharacterized protein LOC103966... 64 5e-07 gb|AAF43236.1|AC012654_20 Contains similarity to the somatic emb... 64 5e-07 ref|XP_008223968.1| PREDICTED: uncharacterized protein LOC103323... 63 6e-07 ref|XP_012449271.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 ref|XP_011025620.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 ref|XP_011025619.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 ref|XP_010530140.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 ref|XP_010471192.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 ref|XP_010428030.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 ref|XP_010415894.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 gb|KFK45125.1| hypothetical protein AALP_AA1G347300 [Arabis alpina] 63 8e-07 ref|XP_012075205.1| PREDICTED: somatic embryogenesis receptor ki... 63 8e-07 gb|AAK82463.1| At1g71830/F14O23_24 [Arabidopsis thaliana] gi|250... 63 8e-07 gb|AAK68073.1|AF384969_1 somatic embryogenesis receptor-like kin... 63 8e-07 ref|NP_174683.1| somatic embryogenesis receptor kinase 2 [Arabid... 63 8e-07 ref|NP_177328.1| somatic embryogenesis receptor kinase 1 [Arabid... 63 8e-07 pdb|4LSX|C Chain C, Plant Steroid Receptor Ectodomain Bound To B... 63 8e-07 >gb|AAU03482.1| somatic embryogenesis receptor-like kinase [Theobroma cacao] Length = 467 Score = 64.7 bits (156), Expect = 2e-07 Identities = 32/36 (88%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+GEVP NGSFSLFTP SFANN DLCGPVT Sbjct: 174 DLSNNRLSGEVPDNGSFSLFTPISFANNLDLCGPVT 209 >ref|XP_007020221.1| Somatic embryogenesis receptor-like kinase 1 isoform 2 [Theobroma cacao] gi|508725549|gb|EOY17446.1| Somatic embryogenesis receptor-like kinase 1 isoform 2 [Theobroma cacao] Length = 467 Score = 64.7 bits (156), Expect = 2e-07 Identities = 32/36 (88%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+GEVP NGSFSLFTP SFANN DLCGPVT Sbjct: 13 DLSNNRLSGEVPDNGSFSLFTPISFANNLDLCGPVT 48 >ref|XP_007020220.1| Somatic embryogenesis receptor-like kinase 2 isoform 1 [Theobroma cacao] gi|508725548|gb|EOY17445.1| Somatic embryogenesis receptor-like kinase 2 isoform 1 [Theobroma cacao] Length = 628 Score = 64.7 bits (156), Expect = 2e-07 Identities = 32/36 (88%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+GEVP NGSFSLFTP SFANN DLCGPVT Sbjct: 174 DLSNNRLSGEVPDNGSFSLFTPISFANNLDLCGPVT 209 >ref|XP_009377456.1| PREDICTED: uncharacterized protein LOC103966056 [Pyrus x bretschneideri] Length = 1042 Score = 63.5 bits (153), Expect = 5e-07 Identities = 35/81 (43%), Positives = 46/81 (56%) Frame = -2 Query: 986 FDYKDGLHRCAISMIFVILFHSLMPGWIFWDEPACLGISKCTLNNAILH*AAKYLEMDTT 807 FD + + AI I +LF L FW+E CL +S+C LN AILH A K+LE D + Sbjct: 53 FDLQSSDDQFAIFCICSLLF--LTTSLTFWEEYTCLDVSQCMLNKAILHVAVKHLESDIS 110 Query: 806 SCLGHFLILGTKVFLPFSLHM 744 + L HFL LGTK + H+ Sbjct: 111 NALAHFLALGTKATIWCGKHL 131 >gb|AAF43236.1|AC012654_20 Contains similarity to the somatic embryogenesis receptor-like kinase from Daucus carota gb|AC007454; It contains 3 leucine rich repeat domains PF|00560 and a eukaryotic protein kinase domain PF|00069 [Arabidopsis thaliana] Length = 601 Score = 63.5 bits (153), Expect = 5e-07 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 536 FGDLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 F DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 145 FLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 182 >ref|XP_008223968.1| PREDICTED: uncharacterized protein LOC103323735 [Prunus mume] Length = 1017 Score = 63.2 bits (152), Expect = 6e-07 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -2 Query: 902 FWDEPACLGISKCTLNNAILH*AAKYLEMDTTSCLGHFLILGTKVFLPFSLHM 744 FW++ CL IS+C LN AIL AAKYLE D ++CL HFL LGTK + H+ Sbjct: 54 FWEDYTCLDISQCMLNRAILQVAAKYLESDISNCLAHFLALGTKASIWCGKHL 106 >ref|XP_012449271.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Gossypium raimondii] gi|763799195|gb|KJB66150.1| hypothetical protein B456_010G129300 [Gossypium raimondii] gi|763799196|gb|KJB66151.1| hypothetical protein B456_010G129300 [Gossypium raimondii] Length = 627 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNN L+GEVP NGSFSLFTP SFANN DLCGPVT Sbjct: 173 DLSNNHLSGEVPDNGSFSLFTPISFANNLDLCGPVT 208 >ref|XP_011025620.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X2 [Populus euphratica] Length = 627 Score = 62.8 bits (151), Expect = 8e-07 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVTLK 420 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT K Sbjct: 173 DLSNNRLSGPVPDNGSFSLFTPISFANNLDLCGPVTGK 210 >ref|XP_011025619.1| PREDICTED: somatic embryogenesis receptor kinase 2-like isoform X1 [Populus euphratica] Length = 627 Score = 62.8 bits (151), Expect = 8e-07 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVTLK 420 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT K Sbjct: 173 DLSNNRLSGPVPDNGSFSLFTPISFANNLDLCGPVTGK 210 >ref|XP_010530140.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Tarenaya hassleriana] Length = 627 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 173 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 208 >ref|XP_010471192.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Camelina sativa] Length = 621 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 167 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 202 >ref|XP_010428030.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Camelina sativa] Length = 621 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 167 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 202 >ref|XP_010415894.1| PREDICTED: somatic embryogenesis receptor kinase 1 [Camelina sativa] Length = 621 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 167 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 202 >gb|KFK45125.1| hypothetical protein AALP_AA1G347300 [Arabis alpina] Length = 627 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 173 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 208 >ref|XP_012075205.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Jatropha curcas] gi|643726547|gb|KDP35227.1| hypothetical protein JCGZ_09386 [Jatropha curcas] Length = 624 Score = 62.8 bits (151), Expect = 8e-07 Identities = 32/38 (84%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVTLK 420 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT K Sbjct: 170 DLSNNRLSGPVPDNGSFSLFTPISFANNLDLCGPVTGK 207 >gb|AAK82463.1| At1g71830/F14O23_24 [Arabidopsis thaliana] gi|25090706|gb|AAN72307.1| At1g71830/F14O23_24 [Arabidopsis thaliana] Length = 625 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 171 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 206 >gb|AAK68073.1|AF384969_1 somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] Length = 628 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 174 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 209 >ref|NP_174683.1| somatic embryogenesis receptor kinase 2 [Arabidopsis thaliana] gi|75338634|sp|Q9XIC7.1|SERK2_ARATH RecName: Full=Somatic embryogenesis receptor kinase 2; Short=AtSERK2; AltName: Full=Somatic embryogenesis receptor-like kinase 2; Flags: Precursor gi|5091623|gb|AAD39611.1|AC007454_10 Similar to gb|U93048 somatic embryogenesis receptor-like kinase from Daucus carota, contains 4 PF|00560 Leucine Rich Repeat domains and a PF|00069 Eukaryotic protein kinase domain [Arabidopsis thaliana] gi|110739280|dbj|BAF01553.1| hypothetical protein [Arabidopsis thaliana] gi|224589414|gb|ACN59241.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332193565|gb|AEE31686.1| somatic embryogenesis receptor kinase 2 [Arabidopsis thaliana] Length = 628 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 174 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 209 >ref|NP_177328.1| somatic embryogenesis receptor kinase 1 [Arabidopsis thaliana] gi|254814128|sp|Q94AG2.2|SERK1_ARATH RecName: Full=Somatic embryogenesis receptor kinase 1; Short=AtSERK1; AltName: Full=Somatic embryogenesis receptor-like kinase 1; Flags: Precursor gi|224589475|gb|ACN59271.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332197117|gb|AEE35238.1| somatic embryogenesis receptor kinase 1 [Arabidopsis thaliana] Length = 625 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 171 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 206 >pdb|4LSX|C Chain C, Plant Steroid Receptor Ectodomain Bound To Brassinolide And Serk1 Co- Receptor Ectodomain gi|538261335|pdb|4LSX|D Chain D, Plant Steroid Receptor Ectodomain Bound To Brassinolide And Serk1 Co- Receptor Ectodomain Length = 203 Score = 62.8 bits (151), Expect = 8e-07 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%) Frame = -2 Query: 530 DLSNNRLTGEVPANGSFSLFTPRSFANN-DLCGPVT 426 DLSNNRL+G VP NGSFSLFTP SFANN DLCGPVT Sbjct: 152 DLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVT 187