BLASTX nr result
ID: Cinnamomum23_contig00010941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00010941 (317 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274999.1| PREDICTED: pentatricopeptide repeat-containi... 80 7e-13 emb|CAN71191.1| hypothetical protein VITISV_019119 [Vitis vinifera] 80 7e-13 ref|XP_008786549.1| PREDICTED: pentatricopeptide repeat-containi... 78 2e-12 ref|XP_010930843.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 gb|KEH32829.1| pentatricopeptide (PPR) repeat protein [Medicago ... 75 1e-11 ref|XP_009393799.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_012570984.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_010244051.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_010097008.1| hypothetical protein L484_024932 [Morus nota... 67 4e-09 ref|XP_002306238.1| hypothetical protein POPTR_0005s06190g [Popu... 67 4e-09 ref|XP_011007577.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_010648293.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_012087643.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 emb|CBI20594.3| unnamed protein product [Vitis vinifera] 67 5e-09 ref|XP_009402221.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 gb|EMT33270.1| Pentatricopeptide repeat-containing protein [Aegi... 65 2e-08 ref|XP_011620822.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_010920669.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_010237844.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_004303223.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 >ref|XP_002274999.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Vitis vinifera] gi|296088567|emb|CBI37558.3| unnamed protein product [Vitis vinifera] Length = 492 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLPEGY 136 S+ R +MRELGLVKTPGCSWI + GRVH+FYQ D+SHP IYE L+ + +++LP+G+ Sbjct: 432 SRTRAKMRELGLVKTPGCSWITVAGRVHKFYQEDLSHPETQMIYETLHGIVNILMLPKGW 491 >emb|CAN71191.1| hypothetical protein VITISV_019119 [Vitis vinifera] Length = 880 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/60 (58%), Positives = 47/60 (78%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLPEGY 136 S+ R +MRELGLVKTPGCSWI + GRVH+FYQ D+SHP IYE L+ + +++LP+G+ Sbjct: 820 SRTRAKMRELGLVKTPGCSWITVAGRVHKFYQEDLSHPETQMIYETLHGIVNILMLPKGW 879 >ref|XP_008786549.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Phoenix dactylifera] Length = 446 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 1/62 (1%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMV-LPEG 139 ++MR RMRE G+VKTPGCSW+++KGR+H FYQG + HP N+I+E+L+ L+ +M +G Sbjct: 385 AQMRSRMREFGMVKTPGCSWVDVKGRLHAFYQGGVPHPSANRIHELLDTLTKVMTNSDDG 444 Query: 138 YG 133 +G Sbjct: 445 HG 446 >ref|XP_010930843.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Elaeis guineensis] Length = 499 Score = 77.4 bits (189), Expect = 3e-12 Identities = 32/54 (59%), Positives = 45/54 (83%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MM 154 ++MR RMRE G+VK PGCSWI++KGR+H FYQG +SHP+ +I E+L++L+ MM Sbjct: 438 AQMRSRMREFGMVKIPGCSWIDVKGRMHVFYQGSVSHPLAKRINEVLDVLAKMM 491 >gb|KEH32829.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 505 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/54 (61%), Positives = 43/54 (79%), Gaps = 4/54 (7%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKN----KIYEILNLL 166 S +R +MR+LGLVKTPGCSWIN+ GR H+FYQGD+SHP+ + ++YEI N L Sbjct: 430 STIRGKMRDLGLVKTPGCSWINIAGRAHKFYQGDLSHPLSHIICKRVYEISNTL 483 >ref|XP_009393799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Musa acuminata subsp. malaccensis] gi|695013994|ref|XP_009393800.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Musa acuminata subsp. malaccensis] Length = 501 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLPEGY 136 +K+R RM+EL +VKTPGCSWI++KGR+ FYQGD+SHP I+E+LN L+ M Sbjct: 436 AKVRVRMKELEMVKTPGCSWIDVKGRLQAFYQGDVSHPSVKHIHEMLNWLTQTMTTSTMV 495 Query: 135 G*LNWH 118 L+WH Sbjct: 496 D-LDWH 500 >ref|XP_012570984.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] gi|828310120|ref|XP_012570985.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] gi|828310122|ref|XP_012570986.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] gi|828310124|ref|XP_012570987.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] gi|828310126|ref|XP_012570988.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] gi|828310128|ref|XP_012570989.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] gi|828310130|ref|XP_012570990.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cicer arietinum] Length = 498 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/61 (52%), Positives = 44/61 (72%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLPEGY 136 S +R +MR+LGL+KTPGCSWIN GR H+FYQGD+SHP+ + I +IL +S + + Sbjct: 430 STVRAKMRDLGLIKTPGCSWINTAGRAHKFYQGDLSHPLSDMICKILYEISNTQISTDDL 489 Query: 135 G 133 G Sbjct: 490 G 490 >ref|XP_010244051.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Nelumbo nucifera] Length = 492 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = -3 Query: 312 KMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLP 145 K+R RMRELGL K+PGCSW+ ++GRV RFYQGD+SH E L + M+LP Sbjct: 433 KIRSRMRELGLTKSPGCSWVTIEGRVRRFYQGDLSHRWVKITCETLERIIRTMMLP 488 >ref|XP_010097008.1| hypothetical protein L484_024932 [Morus notabilis] gi|587877600|gb|EXB66635.1| hypothetical protein L484_024932 [Morus notabilis] Length = 496 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILN 172 S +R +M++LGLVKTPGCSWI + G +H+FYQGD SHP+ IYE L+ Sbjct: 433 SFIRAKMKDLGLVKTPGCSWIIISGTLHKFYQGDHSHPLSVLIYETLD 480 >ref|XP_002306238.1| hypothetical protein POPTR_0005s06190g [Populus trichocarpa] gi|222855687|gb|EEE93234.1| hypothetical protein POPTR_0005s06190g [Populus trichocarpa] Length = 512 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -3 Query: 306 RKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLPE 142 R +MRELGL KTPGCSWI + G VH+FYQG SHP+ EIL+ + +++LP+ Sbjct: 435 RAKMRELGLAKTPGCSWITIAGTVHKFYQGCHSHPLTKVTCEILDRMIKVLMLPD 489 >ref|XP_011007577.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Populus euphratica] gi|743926806|ref|XP_011007578.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Populus euphratica] Length = 506 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -3 Query: 306 RKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLP 145 R +MRELGL KTPGCSWI + G VH+FYQG SHP+ EIL+ + +++LP Sbjct: 435 RAKMRELGLAKTPGCSWITIAGTVHKFYQGCHSHPLTKVTCEILDRMIKLLMLP 488 >ref|XP_010648293.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Vitis vinifera] Length = 628 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/56 (53%), Positives = 38/56 (67%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVL 148 +K R RMRE G++KTPGCSWI + VH F+ GD+SHP NKIY ++ L M L Sbjct: 479 AKCRLRMRENGVLKTPGCSWIEVDNTVHEFFMGDLSHPESNKIYSMIRELMWKMKL 534 >ref|XP_012087643.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Jatropha curcas] gi|643710864|gb|KDP24783.1| hypothetical protein JCGZ_25404 [Jatropha curcas] Length = 494 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = -3 Query: 312 KMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVLP 145 ++R RMRELGLVKTPGCSWI + G + +FYQGD SH N I + L+ + +M LP Sbjct: 433 RIRTRMRELGLVKTPGCSWITIAGTICKFYQGDNSHTQTNLICDTLDHMIKVMALP 488 >emb|CBI20594.3| unnamed protein product [Vitis vinifera] Length = 572 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/56 (53%), Positives = 38/56 (67%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVL 148 +K R RMRE G++KTPGCSWI + VH F+ GD+SHP NKIY ++ L M L Sbjct: 419 AKCRLRMRENGVLKTPGCSWIEVDNTVHEFFMGDLSHPESNKIYSMIRELMWKMKL 474 >ref|XP_009402221.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820 [Musa acuminata subsp. malaccensis] Length = 696 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLL 166 +++R M+E G+ KTPGCSW+ +KG VH F+ GDISHP+ N+IY L+ L Sbjct: 547 ARLRLVMKEKGIQKTPGCSWVELKGVVHEFHVGDISHPLSNEIYSKLDEL 596 >gb|EMT33270.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 419 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = -3 Query: 309 MRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLL 166 +R RMRELG+VKTPGCSW+++KGR H FYQG I ++ +++ IL+ L Sbjct: 366 LRLRMRELGMVKTPGCSWVDVKGRAHAFYQGSIPSYLRRRMFWILDRL 413 >ref|XP_011620822.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Amborella trichopoda] Length = 468 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -3 Query: 306 RKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILN 172 R RMRE G+VKTPGCSWI + VH F+ GD SHP +IYE++N Sbjct: 321 RLRMREKGVVKTPGCSWIEVDNMVHEFFMGDRSHPDSGRIYEMVN 365 >ref|XP_010920669.1| PREDICTED: pentatricopeptide repeat-containing protein ELI1, chloroplastic-like [Elaeis guineensis] Length = 626 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLLS*MMVL 148 +K R RMRE +VK PGCSWI + RV+ F+ GD SHP KIY ++N L+ M L Sbjct: 477 AKCRLRMREKRVVKMPGCSWIEVDNRVYEFFMGDRSHPQSEKIYSMINALNLRMKL 532 >ref|XP_010237844.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Brachypodium distachyon] gi|721677978|ref|XP_003576175.2| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Brachypodium distachyon] Length = 434 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/48 (54%), Positives = 38/48 (79%) Frame = -3 Query: 309 MRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLL 166 +R RMRELG+VKTPGCSW+++KGR + FYQG I ++ +++ IL+ L Sbjct: 366 LRSRMRELGMVKTPGCSWVDVKGRAYAFYQGSIPRYLRRQMFWILDRL 413 >ref|XP_004303223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Fragaria vesca subsp. vesca] Length = 857 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -3 Query: 315 SKMRKRMRELGLVKTPGCSWINMKGRVHRFYQGDISHPMKNKIYEILNLL 166 SKMR+RMR G+ K PGCSWI +K VH F+ GD +HP ++YE L+LL Sbjct: 785 SKMRRRMRYDGMKKEPGCSWIEVKDEVHAFFVGDKAHPRSTELYERLDLL 834