BLASTX nr result
ID: Cinnamomum23_contig00010849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00010849 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP20463.1| hypothetical protein JCGZ_06008 [Jatropha curcas] 86 1e-14 gb|EQL27844.1| hypothetical protein BDFG_09353 [Blastomyces derm... 82 1e-13 gb|KKZ68647.1| hypothetical protein EMCG_05750, partial [Emmonsi... 80 7e-13 dbj|GAO47200.1| hypothetical protein G7K_1410-t1 [Saitoella comp... 67 6e-09 ref|XP_007706090.1| hypothetical protein COCSADRAFT_104431, part... 49 8e-09 gb|EGC42647.1| transcript antisense to ribosomal RNA protein, pa... 49 1e-08 ref|XP_007928849.1| hypothetical protein MYCFIDRAFT_54532 [Pseud... 57 6e-06 >gb|KDP20463.1| hypothetical protein JCGZ_06008 [Jatropha curcas] Length = 111 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -2 Query: 143 TGFSPSVTSCSKELSPGPTPEHPLQITTRTPKEPDFKFELLPLHSPL 3 TGFSPS T+CSK L P PTP+HPLQITTRTP+ PDFKFELLPLHSPL Sbjct: 9 TGFSPSGTACSKALGPVPTPKHPLQITTRTPEGPDFKFELLPLHSPL 55 >gb|EQL27844.1| hypothetical protein BDFG_09353 [Blastomyces dermatitidis ATCC 26199] Length = 98 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -2 Query: 146 KTGFSPSVTSCSKELSPGPTPEHPLQITTRTPKEPDFKFELLPLHSPL 3 KTGFSPS T S+ L P P P+HPLQITTR PKEPDFKFELLPLHSPL Sbjct: 8 KTGFSPSATPRSRGLRPRPRPKHPLQITTRAPKEPDFKFELLPLHSPL 55 >gb|KKZ68647.1| hypothetical protein EMCG_05750, partial [Emmonsia crescens UAMH 3008] Length = 69 Score = 79.7 bits (195), Expect = 7e-13 Identities = 43/69 (62%), Positives = 45/69 (65%) Frame = -3 Query: 208 AAFPXXXXXXXXXXXXXNPWQRRGSHPL*RPVPRNLARARHRSILCKLQLGPRRSQISNL 29 AAFP +RR SHPL RPVP +L R RSIL KLQLGPRRSQISNL Sbjct: 1 AAFPNNSTRRRSFTWAKPAGRRRDSHPLRRPVPGDLDRGHARSILYKLQLGPRRSQISNL 60 Query: 28 SFCRFTRRY 2 SFCRFTRRY Sbjct: 61 SFCRFTRRY 69 >dbj|GAO47200.1| hypothetical protein G7K_1410-t1 [Saitoella complicata NRRL Y-17804] Length = 241 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 125 VTSCSKELSPGPTPEHPLQITTRTPKEPDFKFELLPLHSPL 3 +TSCSKEL PGP P+ L+ITTRT + PDFKFEL PLHSPL Sbjct: 1 MTSCSKELKPGPHPKTLLEITTRTAERPDFKFELFPLHSPL 41 >ref|XP_007706090.1| hypothetical protein COCSADRAFT_104431, partial [Bipolaris sorokiniana ND90Pr] gi|451844890|gb|EMD58210.1| hypothetical protein COCSADRAFT_104431, partial [Bipolaris sorokiniana ND90Pr] Length = 54 Score = 49.3 bits (116), Expect(2) = 8e-09 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +1 Query: 55 VRVVICRGCSGVGPGLSSLEQDVTEGENPV 144 VRVVICRG G G G SSLEQDVTEGENP+ Sbjct: 1 VRVVICRGRFGFGSGPSSLEQDVTEGENPL 30 Score = 37.0 bits (84), Expect(2) = 8e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +2 Query: 164 PCGAPSTSRVVWECSS 211 PC APSTSRVVWECSS Sbjct: 32 PCKAPSTSRVVWECSS 47 >gb|EGC42647.1| transcript antisense to ribosomal RNA protein, partial [Histoplasma capsulatum H88] Length = 199 Score = 48.5 bits (114), Expect(2) = 1e-08 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = -3 Query: 208 AAFPXXXXXXXXXXXXXNPWQRRGSHPL*RPVPRNLARARHRSILCKLQLGP 53 AAFP +RR SHPL RPVP +L R R RSILCKLQL P Sbjct: 30 AAFPNNSTRRRSFTRARPAGRRRDSHPLRRPVPGDLDRGRARSILCKLQLRP 81 Score = 37.4 bits (85), Expect(2) = 1e-08 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -2 Query: 71 QITTRTPKEPDFKFELLPLHSPL 3 ++ R P PDFKFELLPLHSPL Sbjct: 76 KLQLRPPGGPDFKFELLPLHSPL 98 >ref|XP_007928849.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] gi|452980740|gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 155 SLAKTGFSPSVTSCSKELSPGPTPEHPLQITTR 57 S ++TGFSPS+TSCSKEL P TP+HPLQITTR Sbjct: 142 SQSRTGFSPSMTSCSKELRPAATPKHPLQITTR 174