BLASTX nr result
ID: Cinnamomum23_contig00010493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00010493 (309 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN07361.1| hypothetical protein AMTR_s00019p00236090 [Ambore... 57 4e-06 >gb|ERN07361.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda] Length = 604 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 94 KRLRNLMAMIDEPLYPIAILIDELKNEDIQL 2 +RL N MAM+DEPLYPIAILIDELKNED+QL Sbjct: 13 ERLENFMAMVDEPLYPIAILIDELKNEDLQL 43