BLASTX nr result
ID: Cinnamomum23_contig00010419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00010419 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007010948.1| LRR and NB-ARC domains-containing disease re... 57 5e-06 >ref|XP_007010948.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508727861|gb|EOY19758.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 975 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/67 (38%), Positives = 46/67 (68%) Frame = -1 Query: 291 DGFEQLKWLRSLTISDCPELKHFPPLQYLTTLERLVIRNCRLAKEQLQKEIEQDRCNVSH 112 +GF+ + L+SL+I++CP+LK P + L +L +L IRNC + K++ +K+ + N++H Sbjct: 903 NGFQNITSLQSLSINNCPKLKSIPREEMLPSLLQLCIRNCPVLKKRCKKDKGKQWSNITH 962 Query: 111 ICYIEID 91 I Y+ ID Sbjct: 963 IPYVTID 969