BLASTX nr result
ID: Cinnamomum23_contig00010285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00010285 (214 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|3J61|II Chain i, Localization Of The Large Subunit Ribosomal... 66 8e-09 ref|XP_006654512.1| PREDICTED: 60S ribosomal protein L36-2-like ... 66 8e-09 gb|EMT04101.1| hypothetical protein F775_43985 [Aegilops tauschii] 66 8e-09 gb|EMT02216.1| 60S ribosomal protein L36-2 [Aegilops tauschii] 66 8e-09 gb|EMT26739.1| 60S ribosomal protein L36-2 [Aegilops tauschii] 66 8e-09 gb|EMS68428.1| 60S ribosomal protein L36-3 [Triticum urartu] 66 8e-09 gb|EMS49232.1| 60S ribosomal protein L36-2 [Triticum urartu] 66 8e-09 ref|XP_003568301.1| PREDICTED: 60S ribosomal protein L36-3-like ... 66 8e-09 ref|XP_010232542.1| PREDICTED: 60S ribosomal protein L36-3-like ... 66 8e-09 dbj|BAJ92829.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 8e-09 dbj|BAJ98221.1| predicted protein [Hordeum vulgare subsp. vulgar... 66 8e-09 ref|NP_001055753.1| Os05g0459900 [Oryza sativa Japonica Group] g... 66 8e-09 ref|XP_011045934.1| PREDICTED: 60S ribosomal protein L36-2-like ... 65 1e-08 ref|XP_007206165.1| hypothetical protein PRUPE_ppa013654mg [Prun... 65 2e-08 ref|XP_010241904.1| PREDICTED: 60S ribosomal protein L36-3-like ... 65 2e-08 ref|XP_010255374.1| PREDICTED: 60S ribosomal protein L36-2-like ... 65 2e-08 ref|XP_007051819.1| Ribosomal protein L36e family protein isofor... 65 2e-08 ref|XP_007051818.1| Ribosomal protein L36e family protein isofor... 65 2e-08 gb|EAY76455.1| hypothetical protein OsI_04390 [Oryza sativa Indi... 64 3e-08 ref|NP_001044760.1| Os01g0840700 [Oryza sativa Japonica Group] g... 64 3e-08 >pdb|3J61|II Chain i, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|57471698|gb|AAW50980.1| ribosomal protein L36 [Triticum aestivum] Length = 112 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >ref|XP_006654512.1| PREDICTED: 60S ribosomal protein L36-2-like [Oryza brachyantha] Length = 113 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >gb|EMT04101.1| hypothetical protein F775_43985 [Aegilops tauschii] Length = 101 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >gb|EMT02216.1| 60S ribosomal protein L36-2 [Aegilops tauschii] Length = 150 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >gb|EMT26739.1| 60S ribosomal protein L36-2 [Aegilops tauschii] Length = 113 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >gb|EMS68428.1| 60S ribosomal protein L36-3 [Triticum urartu] Length = 121 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >gb|EMS49232.1| 60S ribosomal protein L36-2 [Triticum urartu] Length = 141 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >ref|XP_003568301.1| PREDICTED: 60S ribosomal protein L36-3-like [Brachypodium distachyon] Length = 111 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >ref|XP_010232542.1| PREDICTED: 60S ribosomal protein L36-3-like [Brachypodium distachyon] Length = 110 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >dbj|BAJ92829.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 112 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >dbj|BAJ98221.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326498925|dbj|BAK02448.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326519440|dbj|BAJ96719.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 111 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >ref|NP_001055753.1| Os05g0459900 [Oryza sativa Japonica Group] gi|47900317|gb|AAT39164.1| putative 60S ribosomal protein L36 [Oryza sativa Japonica Group] gi|113579304|dbj|BAF17667.1| Os05g0459900 [Oryza sativa Japonica Group] gi|125552609|gb|EAY98318.1| hypothetical protein OsI_20226 [Oryza sativa Indica Group] gi|215765146|dbj|BAG86843.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631851|gb|EEE63983.1| hypothetical protein OsJ_18810 [Oryza sativa Japonica Group] Length = 113 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAPSQPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >ref|XP_011045934.1| PREDICTED: 60S ribosomal protein L36-2-like isoform X1 [Populus euphratica] Length = 117 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 109 VLAMAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 V AMAP QP +GLFVGLNKGHIVTK+E+APRPSDRK Sbjct: 5 VNAMAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRK 40 >ref|XP_007206165.1| hypothetical protein PRUPE_ppa013654mg [Prunus persica] gi|645220637|ref|XP_008241117.1| PREDICTED: 60S ribosomal protein L36-2-like [Prunus mume] gi|462401807|gb|EMJ07364.1| hypothetical protein PRUPE_ppa013654mg [Prunus persica] Length = 110 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAP+ PKSG+FVGLNKGHIVTKRE+APRPSDRK Sbjct: 1 MAPAAPKSGIFVGLNKGHIVTKRELAPRPSDRK 33 >ref|XP_010241904.1| PREDICTED: 60S ribosomal protein L36-3-like [Nelumbo nucifera] Length = 110 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAP QPKSGLFVGLNKGHIVTK+E+APRPS+RK Sbjct: 1 MAPQQPKSGLFVGLNKGHIVTKKELAPRPSNRK 33 >ref|XP_010255374.1| PREDICTED: 60S ribosomal protein L36-2-like [Nelumbo nucifera] gi|719998320|ref|XP_010255375.1| PREDICTED: 60S ribosomal protein L36-2-like [Nelumbo nucifera] Length = 110 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAP QPKSGLFVGLNKGH VTK+E+APRPSDRK Sbjct: 1 MAPQQPKSGLFVGLNKGHTVTKKELAPRPSDRK 33 >ref|XP_007051819.1| Ribosomal protein L36e family protein isoform 3, partial [Theobroma cacao] gi|508704080|gb|EOX95976.1| Ribosomal protein L36e family protein isoform 3, partial [Theobroma cacao] Length = 125 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 106 LAMAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 L MAP QP +GLFVGLNKGH+VTK+E+APRPSDRK Sbjct: 23 LVMAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRK 57 >ref|XP_007051818.1| Ribosomal protein L36e family protein isoform 2, partial [Theobroma cacao] gi|508704079|gb|EOX95975.1| Ribosomal protein L36e family protein isoform 2, partial [Theobroma cacao] Length = 131 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 106 LAMAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 L MAP QP +GLFVGLNKGH+VTK+E+APRPSDRK Sbjct: 22 LVMAPKQPNTGLFVGLNKGHVVTKKELAPRPSDRK 56 >gb|EAY76455.1| hypothetical protein OsI_04390 [Oryza sativa Indica Group] Length = 110 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAP QPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPPQPKSGLFVGINKGHVVTKRELPPRPSDRK 33 >ref|NP_001044760.1| Os01g0840700 [Oryza sativa Japonica Group] gi|21104629|dbj|BAB93221.1| putative 60S ribosomal protein L36 [Oryza sativa Japonica Group] gi|113534291|dbj|BAF06674.1| Os01g0840700 [Oryza sativa Japonica Group] gi|222619514|gb|EEE55646.1| hypothetical protein OsJ_04027 [Oryza sativa Japonica Group] Length = 110 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 100 MAPSQPKSGLFVGLNKGHIVTKREVAPRPSDRK 2 MAP QPKSGLFVG+NKGH+VTKRE+ PRPSDRK Sbjct: 1 MAPPQPKSGLFVGINKGHVVTKRELPPRPSDRK 33