BLASTX nr result
ID: Cinnamomum23_contig00010040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00010040 (293 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 70 4e-10 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 66 1e-08 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 61 3e-07 gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium r... 59 1e-06 ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Popu... 57 5e-06 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 70.5 bits (171), Expect = 4e-10 Identities = 42/83 (50%), Positives = 51/83 (61%) Frame = -1 Query: 290 SSDLRACNSNEGNEVVRTG*LGL*GWAQGCFAGLPVPSRVVDYVAWSKAHAAWPFKRRAL 111 SS RAC+ + G +VV G + Q +G PVPSR + +V +KA A K RA Sbjct: 40 SSVARACDPSGGIKVVGRGLESIGPGLQRLLSGPPVPSRELIHVVRAKARATCVLKWRAP 99 Query: 110 RQAGFTEQRVPPALDSGRITGRC 42 R+AGFTEQR PPA SGRITGRC Sbjct: 100 REAGFTEQRKPPAPGSGRITGRC 122 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/53 (62%), Positives = 35/53 (66%) Frame = -3 Query: 201 LCWLARSKSGSGLCGLVEGPCCLAL*EEGTAPGWLHRAASTSRSRQWKDNGPV 43 + WLARSK CGL EGP + EGTA GW HRAA TS S QWKDNGPV Sbjct: 1 MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPV 53 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = -1 Query: 197 AGLPVPSRVVDYVAWSKAHAAWPFKRRALRQAGFTEQRVPPALDSGRITGRCSLGPS 27 AGLP PS + +V +K + R LR+AGFTEQR PPALDSG ITG C L P+ Sbjct: 9 AGLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSCHLIPA 65 >gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium raimondii] Length = 79 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/62 (50%), Positives = 39/62 (62%) Frame = -1 Query: 197 AGLPVPSRVVDYVAWSKAHAAWPFKRRALRQAGFTEQRVPPALDSGRITGRCSLGPSTPQ 18 +GL VPS+ + V+ +KA W + +A R+AGFTEQR P L SGRITG C L P Sbjct: 10 SGLSVPSQELSQVSCAKAWVLWLLEWKAPREAGFTEQRKLPPLGSGRITGCCHLDPYWIH 69 Query: 17 GP 12 GP Sbjct: 70 GP 71 >ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] gi|550305511|gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -1 Query: 206 GCF-AGLPVPSRVVDYVAWSKAHAAWPFKRRALRQAGFTEQRVPPALDSGRITGRCSLGP 30 GCF +G PVPS+ + K +W + RA R+AG TEQR PA SGRITGRC L P Sbjct: 8 GCFLSGPPVPSQELSQGILVKTWVSWLLEGRAQREAGLTEQRSLPAPGSGRITGRCHLDP 67