BLASTX nr result
ID: Cinnamomum23_contig00009479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00009479 (304 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] 71 2e-10 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 PEQSQYIWRKTIPHIEVGMGSGVFTSHRSARFLSFP 110 PEQSQYIWRKTIPHIEVGMGSGVFTS+RSARF+ P Sbjct: 48 PEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIP 83 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 110 GKGKKPGTTVRRENTRSHSDLDMWNRLAPYVLRLFG 3 G KPGTTVRRENTRSHSDLDMWNRLAPYVL+LFG Sbjct: 565 GNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFG 600