BLASTX nr result
ID: Cinnamomum23_contig00009232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00009232 (440 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010941649.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_010276204.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >ref|XP_010941649.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Elaeis guineensis] Length = 601 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/72 (45%), Positives = 51/72 (70%) Frame = -2 Query: 217 SSPTIRTMVESALNHPFIESRCRTLLFGCENKLSGRAKHSHGTVEDGKCDRFFLDRRGML 38 +SP+ R M+++AL H ++ RC+ + G EN L GR K+S+GT++ + + FLD+RG Sbjct: 19 TSPS-RMMIKAALCHSIVKLRCKFI--GRENILRGRGKNSNGTIDKERHESVFLDKRGRW 75 Query: 37 RSFDAKRLSRKK 2 R+FD K+LSRKK Sbjct: 76 RTFDHKKLSRKK 87 >ref|XP_010276204.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Nelumbo nucifera] gi|720065214|ref|XP_010276206.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Nelumbo nucifera] Length = 584 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -2 Query: 196 MVESALNHPFIESRCRTLLFGCENKLSGRAKHSH-GTVEDGKCDRFFLDRRGMLRSFDAK 20 M+E +HPF+E R R LF C++ +K S V+ K D FLD+RG+ RS + K Sbjct: 5 MIECTSSHPFLEPRSRLALFDCKSNFRWSSKKSQVQPVDKHKHDNLFLDKRGVWRSINPK 64 Query: 19 RLSRKK 2 RLSRKK Sbjct: 65 RLSRKK 70