BLASTX nr result
ID: Cinnamomum23_contig00009036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00009036 (275 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 112 2e-30 gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] 74 4e-11 gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Go... 56 8e-06 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 112 bits (280), Expect(2) = 2e-30 Identities = 54/57 (94%), Positives = 54/57 (94%) Frame = +2 Query: 2 PNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTSPLQSSIKLAFPRRYEMG 172 PNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSST PLQSSIKLAF RR EMG Sbjct: 18 PNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIKLAFSRRSEMG 74 Score = 47.0 bits (110), Expect(2) = 2e-30 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +3 Query: 171 GALPSPIVCIGLASSRTKEAFWRARACRNADY 266 G PSPIVCIGLASSR+K + RARACR AD+ Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADH 104 >gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] Length = 190 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 244 RARQNASLVRDEAKPIHTIGEGSAPHFIAPGERKFDGGLER 122 R RQNASLVRDEAKP +TIGEG PHFIAPGERKFD GLER Sbjct: 80 RRRQNASLVRDEAKPKYTIGEGKTPHFIAPGERKFDRGLER 120 >gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Gossypium raimondii] Length = 231 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 172 GRFLRLSYVSAWLRPEPRRHSGGRVR 249 G FLRLSYVSAWLRPEPRRHSGGRVR Sbjct: 156 GSFLRLSYVSAWLRPEPRRHSGGRVR 181