BLASTX nr result
ID: Cinnamomum23_contig00008702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00008702 (462 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010242923.1| PREDICTED: riboflavin synthase-like [Nelumbo... 76 1e-11 ref|XP_010272471.1| PREDICTED: riboflavin synthase-like [Nelumbo... 75 1e-11 emb|CDP14781.1| unnamed protein product [Coffea canephora] 74 4e-11 ref|XP_006482451.1| PREDICTED: riboflavin synthase-like isoform ... 74 4e-11 ref|XP_006430973.1| hypothetical protein CICLE_v10013903mg [Citr... 74 4e-11 ref|XP_004301447.1| PREDICTED: riboflavin synthase [Fragaria ves... 74 4e-11 ref|XP_002274029.1| PREDICTED: riboflavin synthase [Vitis vinifera] 74 4e-11 ref|XP_011098022.1| PREDICTED: riboflavin synthase [Sesamum indi... 74 5e-11 ref|XP_010110213.1| Riboflavin synthase alpha chain [Morus notab... 73 8e-11 gb|KHG06669.1| Riboflavin synthase alpha chain [Gossypium arboreum] 73 8e-11 ref|XP_007029000.1| Riboflavin synthase alpha chain, putative is... 72 1e-10 ref|XP_008337473.1| PREDICTED: LOW QUALITY PROTEIN: riboflavin s... 72 1e-10 ref|XP_008381246.1| PREDICTED: riboflavin synthase-like [Malus d... 72 1e-10 ref|XP_008229154.1| PREDICTED: riboflavin synthase [Prunus mume]... 72 1e-10 ref|XP_010035734.1| PREDICTED: riboflavin synthase [Eucalyptus g... 72 1e-10 ref|XP_002517920.1| Riboflavin synthase alpha chain, putative [R... 72 1e-10 ref|XP_012854807.1| PREDICTED: riboflavin synthase [Erythranthe ... 72 1e-10 ref|XP_006357493.1| PREDICTED: riboflavin synthase-like [Solanum... 72 1e-10 ref|XP_007198837.1| hypothetical protein PRUPE_ppa009738mg [Prun... 72 1e-10 ref|XP_004243342.1| PREDICTED: riboflavin synthase [Solanum lyco... 72 1e-10 >ref|XP_010242923.1| PREDICTED: riboflavin synthase-like [Nelumbo nucifera] Length = 287 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLK 349 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLK Sbjct: 240 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLK 277 >ref|XP_010272471.1| PREDICTED: riboflavin synthase-like [Nelumbo nucifera] Length = 283 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLK 349 FMLVAYTQQKVVIPLKK+GQKVNLEVDILGKYVERLLK Sbjct: 236 FMLVAYTQQKVVIPLKKIGQKVNLEVDILGKYVERLLK 273 >emb|CDP14781.1| unnamed protein product [Coffea canephora] Length = 207 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 154 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 190 >ref|XP_006482451.1| PREDICTED: riboflavin synthase-like isoform X1 [Citrus sinensis] gi|568857800|ref|XP_006482452.1| PREDICTED: riboflavin synthase-like isoform X2 [Citrus sinensis] Length = 282 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 234 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 270 >ref|XP_006430973.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|567876769|ref|XP_006430974.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|557533030|gb|ESR44213.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|557533031|gb|ESR44214.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|641853501|gb|KDO72319.1| hypothetical protein CISIN_1g023449mg [Citrus sinensis] Length = 282 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 234 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 270 >ref|XP_004301447.1| PREDICTED: riboflavin synthase [Fragaria vesca subsp. vesca] Length = 282 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 235 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 271 >ref|XP_002274029.1| PREDICTED: riboflavin synthase [Vitis vinifera] Length = 280 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 233 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 269 >ref|XP_011098022.1| PREDICTED: riboflavin synthase [Sesamum indicum] Length = 284 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQK+VIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 237 FMLVAYTQQKIVIPLKKVGQKVNLEVDILGKYVERLL 273 >ref|XP_010110213.1| Riboflavin synthase alpha chain [Morus notabilis] gi|587938812|gb|EXC25510.1| Riboflavin synthase alpha chain [Morus notabilis] Length = 280 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKK+GQKVNLEVDI+GKYVERLL Sbjct: 233 FMLVAYTQQKVVIPLKKIGQKVNLEVDIMGKYVERLL 269 >gb|KHG06669.1| Riboflavin synthase alpha chain [Gossypium arboreum] Length = 305 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLK 349 FMLVAYTQQKVVIPLK++GQKVNLEVDILGKYVERLL+ Sbjct: 233 FMLVAYTQQKVVIPLKEIGQKVNLEVDILGKYVERLLR 270 >ref|XP_007029000.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|590637019|ref|XP_007029001.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|590637022|ref|XP_007029002.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|508717605|gb|EOY09502.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|508717606|gb|EOY09503.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|508717607|gb|EOY09504.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] Length = 279 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLK+VGQKVNLEVDILGKYVERLL Sbjct: 232 FMLVAYTQQKVVIPLKEVGQKVNLEVDILGKYVERLL 268 >ref|XP_008337473.1| PREDICTED: LOW QUALITY PROTEIN: riboflavin synthase [Malus domestica] Length = 274 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVG KVNLEVDILGKYVERLL Sbjct: 227 FMLVAYTQQKVVIPLKKVGSKVNLEVDILGKYVERLL 263 >ref|XP_008381246.1| PREDICTED: riboflavin synthase-like [Malus domestica] gi|657978607|ref|XP_008381247.1| PREDICTED: riboflavin synthase-like [Malus domestica] gi|657978609|ref|XP_008381248.1| PREDICTED: riboflavin synthase-like [Malus domestica] Length = 274 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLKKVG KVNLEVDILGKYVERLL Sbjct: 227 FMLVAYTQQKVVIPLKKVGSKVNLEVDILGKYVERLL 263 >ref|XP_008229154.1| PREDICTED: riboflavin synthase [Prunus mume] gi|645246019|ref|XP_008229155.1| PREDICTED: riboflavin synthase [Prunus mume] Length = 280 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQ VVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 233 FMLVAYTQQNVVIPLKKVGQKVNLEVDILGKYVERLL 269 >ref|XP_010035734.1| PREDICTED: riboflavin synthase [Eucalyptus grandis] gi|702490646|ref|XP_010035735.1| PREDICTED: riboflavin synthase [Eucalyptus grandis] gi|702490651|ref|XP_010035736.1| PREDICTED: riboflavin synthase [Eucalyptus grandis] gi|629080760|gb|KCW47205.1| hypothetical protein EUGRSUZ_K01017 [Eucalyptus grandis] gi|629080761|gb|KCW47206.1| hypothetical protein EUGRSUZ_K01017 [Eucalyptus grandis] Length = 259 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIP+K+VGQKVNLEVDILGKYVERLL Sbjct: 212 FMLVAYTQQKVVIPMKRVGQKVNLEVDILGKYVERLL 248 >ref|XP_002517920.1| Riboflavin synthase alpha chain, putative [Ricinus communis] gi|223542902|gb|EEF44438.1| Riboflavin synthase alpha chain, putative [Ricinus communis] Length = 286 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQKVVIPLK VGQKVNLEVDILGKYVERLL Sbjct: 239 FMLVAYTQQKVVIPLKNVGQKVNLEVDILGKYVERLL 275 >ref|XP_012854807.1| PREDICTED: riboflavin synthase [Erythranthe guttatus] gi|604303274|gb|EYU22747.1| hypothetical protein MIMGU_mgv1a011260mg [Erythranthe guttata] Length = 287 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQ VVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 240 FMLVAYTQQNVVIPLKKVGQKVNLEVDILGKYVERLL 276 >ref|XP_006357493.1| PREDICTED: riboflavin synthase-like [Solanum tuberosum] Length = 280 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQ VVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 233 FMLVAYTQQNVVIPLKKVGQKVNLEVDILGKYVERLL 269 >ref|XP_007198837.1| hypothetical protein PRUPE_ppa009738mg [Prunus persica] gi|462394132|gb|EMJ00036.1| hypothetical protein PRUPE_ppa009738mg [Prunus persica] Length = 280 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQ VVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 233 FMLVAYTQQNVVIPLKKVGQKVNLEVDILGKYVERLL 269 >ref|XP_004243342.1| PREDICTED: riboflavin synthase [Solanum lycopersicum] Length = 280 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 462 FMLVAYTQQKVVIPLKKVGQKVNLEVDILGKYVERLL 352 FMLVAYTQQ VVIPLKKVGQKVNLEVDILGKYVERLL Sbjct: 233 FMLVAYTQQNVVIPLKKVGQKVNLEVDILGKYVERLL 269