BLASTX nr result
ID: Cinnamomum23_contig00008551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00008551 (509 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847863.1| PREDICTED: uncharacterized protein LOC184375... 57 4e-06 >ref|XP_006847863.1| PREDICTED: uncharacterized protein LOC18437597 [Amborella trichopoda] gi|548851168|gb|ERN09444.1| hypothetical protein AMTR_s00029p00081790 [Amborella trichopoda] Length = 371 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = -2 Query: 178 GINDLQLRIISETEMDPSVSPEILSSNGENCIEHRVSMMDTLAGIAIKYGVEVVE 14 G+ DL R ++ PS S I+SS+G N IEH +S MDTLAG+AIKYGVEV + Sbjct: 25 GVRDLDKRFMAV----PSNSSAIMSSSGVNYIEHHISKMDTLAGVAIKYGVEVAD 75