BLASTX nr result
ID: Cinnamomum23_contig00007973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00007973 (533 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034056.1| Uncharacterized protein TCM_020114 [Theobrom... 57 4e-06 >ref|XP_007034056.1| Uncharacterized protein TCM_020114 [Theobroma cacao] gi|508713085|gb|EOY04982.1| Uncharacterized protein TCM_020114 [Theobroma cacao] Length = 75 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -1 Query: 335 EMYLSLAILITIFIYLFLVILDASWSN-GASFLPPDCCFP 219 EMYLS AI + FIYLFLV+L++ W N G S+LP DCCFP Sbjct: 15 EMYLSFAISLLAFIYLFLVVLESHWRNKGVSWLPQDCCFP 54