BLASTX nr result
ID: Cinnamomum23_contig00007888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00007888 (398 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009395375.1| PREDICTED: U-box domain-containing protein 4... 39 5e-06 ref|XP_010934488.1| PREDICTED: U-box domain-containing protein 4... 41 8e-06 >ref|XP_009395375.1| PREDICTED: U-box domain-containing protein 44-like [Musa acuminata subsp. malaccensis] Length = 1064 Score = 38.5 bits (88), Expect(2) = 5e-06 Identities = 17/41 (41%), Positives = 29/41 (70%) Frame = +1 Query: 19 DGEKQQNACKVLPKERGIAAIIKLIKLPHADLQDEALHILE 141 +GE+ Q+ KVL + GIA I+K++ +LQ++AL++LE Sbjct: 972 EGERLQSGSKVLHESNGIAPIVKVLSSRSTELQEKALNVLE 1012 Score = 38.1 bits (87), Expect(2) = 5e-06 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 6/44 (13%) Frame = +2 Query: 140 RVFRLLEHKQQYGVLVKMPIADITQGE------WYYEALAHLDV 253 R+FRL E+K+ YG L +MP+ DITQ LAHLDV Sbjct: 1013 RIFRLQEYKRIYGALAQMPLVDITQRSNGPVRALAARILAHLDV 1056 >ref|XP_010934488.1| PREDICTED: U-box domain-containing protein 44-like [Elaeis guineensis] Length = 1008 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +1 Query: 19 DGEKQQNACKVLPKERGIAAIIKLIKLPHADLQDEALHILE 141 + E+ Q+ KVL + GIA IIKL+ ++LQ++ALH+LE Sbjct: 916 EAERLQSGSKVLSEMNGIAPIIKLLSSQSSELQEKALHVLE 956 Score = 35.0 bits (79), Expect(2) = 8e-06 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 140 RVFRLLEHKQQYGVLVKMPIADITQ 214 R+FRL E+K+ YG +MP+ DITQ Sbjct: 957 RIFRLEEYKRMYGASAQMPLVDITQ 981