BLASTX nr result
ID: Cinnamomum23_contig00007653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00007653 (876 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006590070.1| PREDICTED: cucumisin-like [Glycine max] gi|7... 59 4e-06 >ref|XP_006590070.1| PREDICTED: cucumisin-like [Glycine max] gi|734397607|gb|KHN30262.1| Cucumisin [Glycine soja] Length = 734 Score = 58.9 bits (141), Expect = 4e-06 Identities = 33/59 (55%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -1 Query: 225 LPLSHLA-NSGLLFHAR-NSFKNPTANILKSEEVRDLLAPCVVSFSSRGPHPLTKGILK 55 LP HL+ N G L H+ N NPTA I KS E +D LAP + SFSSRGP+P+T ILK Sbjct: 431 LPAVHLSSNDGALIHSYINLTGNPTATIFKSNEGKDSLAPYIASFSSRGPNPITPNILK 489