BLASTX nr result
ID: Cinnamomum23_contig00007517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00007517 (201 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007706090.1| hypothetical protein COCSADRAFT_104431, part... 77 3e-12 gb|KGU01097.1| hypothetical protein MEM_06229 [Candida albicans ... 59 4e-09 ref|XP_007416290.1| hypothetical protein MELLADRAFT_93284 [Melam... 66 8e-09 ref|XP_007405676.1| hypothetical protein MELLADRAFT_92518 [Melam... 66 8e-09 ref|XP_007413097.1| hypothetical protein MELLADRAFT_90073 [Melam... 64 4e-08 gb|KDP20463.1| hypothetical protein JCGZ_06008 [Jatropha curcas] 62 1e-07 gb|EQL27844.1| hypothetical protein BDFG_09353 [Blastomyces derm... 57 6e-06 >ref|XP_007706090.1| hypothetical protein COCSADRAFT_104431, partial [Bipolaris sorokiniana ND90Pr] gi|451844890|gb|EMD58210.1| hypothetical protein COCSADRAFT_104431, partial [Bipolaris sorokiniana ND90Pr] Length = 54 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/57 (68%), Positives = 42/57 (73%) Frame = -3 Query: 172 VRVVICRGCFGHDPGLNFLEQNVIEGENPVLTRVYEPCGTPSTSRVVWECSSKWVVN 2 VRVVICRG FG G + LEQ+V EGENP+L PC PSTSRVVWECSSKW VN Sbjct: 1 VRVVICRGRFGFGSGPSSLEQDVTEGENPLL-----PCKAPSTSRVVWECSSKWEVN 52 >gb|KGU01097.1| hypothetical protein MEM_06229 [Candida albicans L26] gi|723178704|gb|KHC52598.1| hypothetical protein MGE_06187 [Candida albicans P75010] Length = 67 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = +3 Query: 3 FTTHFELHSQTTRLVEGVPHGSYTRVKTGFSPSMTFCSKKFNPGSWPKHP 152 FTTH E HSQTTRLVEG H + +TGFSPS+T CSK+ PK P Sbjct: 3 FTTHLESHSQTTRLVEGTLHRPGSSHRTGFSPSVTSCSKEHRQEPGPKIP 52 Score = 28.9 bits (63), Expect(2) = 4e-09 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 152 STNYNSDAESARFQI 196 S+NYNSDA+ ARFQI Sbjct: 53 SSNYNSDAKDARFQI 67 >ref|XP_007416290.1| hypothetical protein MELLADRAFT_93284 [Melampsora larici-populina 98AG31] gi|328851288|gb|EGG00444.1| hypothetical protein MELLADRAFT_93284 [Melampsora larici-populina 98AG31] Length = 83 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 175 SVRVVICRGCFGHDPGLNFLEQNVIEGENPVLTRVYEP-CGTPSTSRVVWECSSKWVVN 2 SVRVVICR P + L+ ++IEGENPV Y+ C T S SRVVWECSSKWVVN Sbjct: 23 SVRVVICRTVIRAGPCTSLLKSSIIEGENPVDDMDYQCICDTVSKSRVVWECSSKWVVN 81 >ref|XP_007405676.1| hypothetical protein MELLADRAFT_92518 [Melampsora larici-populina 98AG31] gi|599390752|ref|XP_007410499.1| hypothetical protein MELLADRAFT_87417 [Melampsora larici-populina 98AG31] gi|599405036|ref|XP_007413096.1| hypothetical protein MELLADRAFT_90074 [Melampsora larici-populina 98AG31] gi|599406988|ref|XP_007413437.1| hypothetical protein MELLADRAFT_90340 [Melampsora larici-populina 98AG31] gi|599417434|ref|XP_007415548.1| hypothetical protein MELLADRAFT_92711 [Melampsora larici-populina 98AG31] gi|599424939|ref|XP_007417433.1| hypothetical protein MELLADRAFT_94731 [Melampsora larici-populina 98AG31] gi|599426088|ref|XP_007417783.1| hypothetical protein MELLADRAFT_95027 [Melampsora larici-populina 98AG31] gi|599427381|ref|XP_007418190.1| hypothetical protein MELLADRAFT_95622 [Melampsora larici-populina 98AG31] gi|599430147|ref|XP_007419027.1| hypothetical protein MELLADRAFT_84536 [Melampsora larici-populina 98AG31] gi|328848491|gb|EGF97704.1| hypothetical protein MELLADRAFT_84536 [Melampsora larici-populina 98AG31] gi|328849359|gb|EGF98541.1| hypothetical protein MELLADRAFT_95622 [Melampsora larici-populina 98AG31] gi|328849784|gb|EGF98958.1| hypothetical protein MELLADRAFT_95027 [Melampsora larici-populina 98AG31] gi|328850089|gb|EGF99258.1| hypothetical protein MELLADRAFT_94731 [Melampsora larici-populina 98AG31] gi|328852049|gb|EGG01198.1| hypothetical protein MELLADRAFT_92711 [Melampsora larici-populina 98AG31] gi|328854168|gb|EGG03302.1| hypothetical protein MELLADRAFT_90340 [Melampsora larici-populina 98AG31] gi|328854517|gb|EGG03649.1| hypothetical protein MELLADRAFT_90074 [Melampsora larici-populina 98AG31] gi|328857143|gb|EGG06261.1| hypothetical protein MELLADRAFT_87417 [Melampsora larici-populina 98AG31] gi|328861972|gb|EGG11074.1| hypothetical protein MELLADRAFT_92518 [Melampsora larici-populina 98AG31] Length = 83 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = -3 Query: 175 SVRVVICRGCFGHDPGLNFLEQNVIEGENPVLTRVYEP-CGTPSTSRVVWECSSKWVVN 2 SVRVVICR P + L+ ++IEGENPV Y+ C T S SRVVWECSSKWVVN Sbjct: 23 SVRVVICRTVIRAGPCTSLLKSSIIEGENPVDDMDYQCICDTVSKSRVVWECSSKWVVN 81 >ref|XP_007413097.1| hypothetical protein MELLADRAFT_90073 [Melampsora larici-populina 98AG31] gi|328854518|gb|EGG03650.1| hypothetical protein MELLADRAFT_90073 [Melampsora larici-populina 98AG31] Length = 83 Score = 63.9 bits (154), Expect = 4e-08 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = -3 Query: 175 SVRVVICRGCFGHDPGLNFLEQNVIEGENPVLTRVYEP-CGTPSTSRVVWECSSKWVVN 2 SVRVVICR P + L+ ++IEGENPV Y+ C S SRVVWECSSKWVVN Sbjct: 23 SVRVVICRTVIRAGPCTSLLKSSIIEGENPVDDMDYQCICDMVSKSRVVWECSSKWVVN 81 >gb|KDP20463.1| hypothetical protein JCGZ_06008 [Jatropha curcas] Length = 111 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = +3 Query: 72 TRVKTGFSPSMTFCSKKFNPGSWPKHPLQITTRTLKAPDFKFE 200 TR TGFSPS T CSK P PKHPLQITTRT + PDFKFE Sbjct: 5 TRPDTGFSPSGTACSKALGPVPTPKHPLQITTRTPEGPDFKFE 47 >gb|EQL27844.1| hypothetical protein BDFG_09353 [Blastomyces dermatitidis ATCC 26199] Length = 98 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = +3 Query: 63 GSYTRVKTGFSPSMTFCSKKFNPGSWPKHPLQITTRTLKAPDFKFE 200 G R KTGFSPS T S+ P PKHPLQITTR K PDFKFE Sbjct: 2 GEAGRPKTGFSPSATPRSRGLRPRPRPKHPLQITTRAPKEPDFKFE 47