BLASTX nr result
ID: Cinnamomum23_contig00007479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00007479 (967 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012092297.1| PREDICTED: BTB/POZ and MATH domain-containin... 77 2e-11 ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus ... 77 2e-11 ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containin... 75 9e-11 ref|XP_007201051.1| hypothetical protein PRUPE_ppa006488mg [Prun... 75 9e-11 ref|XP_010905245.1| PREDICTED: BTB/POZ and MATH domain-containin... 74 2e-10 ref|XP_010905244.1| PREDICTED: BTB/POZ and MATH domain-containin... 74 2e-10 ref|XP_006604419.1| PREDICTED: BTB/POZ and MATH domain-containin... 74 2e-10 ref|XP_008808252.1| PREDICTED: BTB/POZ and MATH domain-containin... 73 3e-10 ref|XP_008808250.1| PREDICTED: BTB/POZ and MATH domain-containin... 73 3e-10 ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containin... 73 3e-10 gb|KDO68823.1| hypothetical protein CISIN_1g015430mg [Citrus sin... 73 3e-10 ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citr... 73 3e-10 ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containin... 73 3e-10 gb|KJB22576.1| hypothetical protein B456_004G055100 [Gossypium r... 72 4e-10 ref|XP_012473531.1| PREDICTED: BTB/POZ and MATH domain-containin... 72 4e-10 gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protei... 72 4e-10 ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containin... 72 4e-10 ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containin... 72 4e-10 ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 72 4e-10 ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containin... 72 8e-10 >ref|XP_012092297.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Jatropha curcas] gi|643704439|gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas] Length = 407 Score = 77.0 bits (188), Expect = 2e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTFNVGGY+WA Sbjct: 33 VNGSHQFKITGYSLSKGLGIGKYIASDTFNVGGYSWA 69 >ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis] gi|223535995|gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 500 Score = 77.0 bits (188), Expect = 2e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTFNVGGY+WA Sbjct: 39 VNGSHQFKITGYSLSKGLGIGKYIASDTFNVGGYSWA 75 >ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Prunus mume] Length = 357 Score = 74.7 bits (182), Expect = 9e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNG+H FKITGYSLSKGIGIGKY ASDTFNVGGY+WA Sbjct: 40 VNGTHHFKITGYSLSKGIGIGKYIASDTFNVGGYSWA 76 >ref|XP_007201051.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica] gi|462396451|gb|EMJ02250.1| hypothetical protein PRUPE_ppa006488mg [Prunus persica] Length = 409 Score = 74.7 bits (182), Expect = 9e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNG+H FKITGYSLSKGIGIGKY ASDTFNVGGY+WA Sbjct: 35 VNGTHHFKITGYSLSKGIGIGKYIASDTFNVGGYSWA 71 >ref|XP_010905245.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X2 [Elaeis guineensis] Length = 359 Score = 73.9 bits (180), Expect = 2e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 41 VNGSHQFKITGYSLSKGMGIGKYIASDTFTVGGYEWA 77 >ref|XP_010905244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like isoform X1 [Elaeis guineensis] Length = 414 Score = 73.9 bits (180), Expect = 2e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 41 VNGSHQFKITGYSLSKGMGIGKYIASDTFTVGGYEWA 77 >ref|XP_006604419.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Glycine max] Length = 410 Score = 73.6 bits (179), Expect = 2e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 V GSHQFKITGYSLSKGIGIGKY ASD F+VGGYNWA Sbjct: 36 VRGSHQFKITGYSLSKGIGIGKYMASDVFSVGGYNWA 72 >ref|XP_008808252.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like isoform X2 [Phoenix dactylifera] Length = 359 Score = 73.2 bits (178), Expect = 3e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 41 VNGSHQFKITGYSLSKGMGIGKYIASDTFAVGGYEWA 77 >ref|XP_008808250.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1-like isoform X1 [Phoenix dactylifera] Length = 414 Score = 73.2 bits (178), Expect = 3e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 41 VNGSHQFKITGYSLSKGMGIGKYIASDTFAVGGYEWA 77 >ref|XP_009599207.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Nicotiana tomentosiformis] Length = 411 Score = 72.8 bits (177), Expect = 3e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSH FKITGYSLSKGIGIGKY ASDTF VGGY+WA Sbjct: 37 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYSWA 73 >gb|KDO68823.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis] Length = 399 Score = 72.8 bits (177), Expect = 3e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 33 VNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWA 69 >ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|568852211|ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|557546400|gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|641849948|gb|KDO68822.1| hypothetical protein CISIN_1g015430mg [Citrus sinensis] Length = 407 Score = 72.8 bits (177), Expect = 3e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 33 VNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAWA 69 >ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Fragaria vesca subsp. vesca] Length = 411 Score = 72.8 bits (177), Expect = 3e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNG+HQFKITGYSLSKG+GIGKY +SD FNVGGY+WA Sbjct: 37 VNGTHQFKITGYSLSKGMGIGKYVSSDVFNVGGYSWA 73 >gb|KJB22576.1| hypothetical protein B456_004G055100 [Gossypium raimondii] Length = 357 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 32 VNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWA 68 >ref|XP_012473531.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Gossypium raimondii] gi|763755244|gb|KJB22575.1| hypothetical protein B456_004G055100 [Gossypium raimondii] Length = 406 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 32 VNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWA 68 >gb|KHG07672.1| BTB/POZ and MATH domain-containing 2 -like protein [Gossypium arboreum] Length = 405 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 32 VNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWA 68 >ref|XP_010326625.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 412 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSH FKITGYSLSKGIGIGKY ASDTF VGGY WA Sbjct: 38 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYTWA 74 >ref|XP_010652109.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] gi|296086694|emb|CBI32329.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 28 VNGSHQFKITGYSLSKGLGIGKYIASDTFVVGGYAWA 64 >ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508702947|gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 72.4 bits (176), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSHQFKITGYSLSKG+GIGKY ASDTF VGGY WA Sbjct: 32 VNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLWA 68 >ref|XP_011082543.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 71.6 bits (174), Expect = 8e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 112 VNGSHQFKITGYSLSKGIGIGKYTASDTFNVGGYNWA 2 VNGSH FKITGYSLSKGIGIGKY ASDTF VGGY WA Sbjct: 36 VNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYAWA 72