BLASTX nr result
ID: Cinnamomum23_contig00006762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00006762 (522 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011622855.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 ref|XP_008795326.1| PREDICTED: putative pentatricopeptide repeat... 61 3e-07 ref|XP_004503024.1| PREDICTED: putative pentatricopeptide repeat... 61 3e-07 ref|XP_011622390.1| PREDICTED: putative pentatricopeptide repeat... 60 4e-07 ref|XP_007137835.1| hypothetical protein PHAVU_009G159700g [Phas... 60 4e-07 ref|XP_009353795.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-07 ref|XP_009353788.1| PREDICTED: putative pentatricopeptide repeat... 60 6e-07 gb|KHN09686.1| Putative pentatricopeptide repeat-containing prot... 60 7e-07 ref|XP_003528082.1| PREDICTED: putative pentatricopeptide repeat... 60 7e-07 gb|KHN31231.1| Putative pentatricopeptide repeat-containing prot... 59 1e-06 ref|XP_008344493.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_008344488.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_008344479.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_006579323.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_010912874.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_009358063.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_002306009.1| hypothetical protein POPTR_0004s14190g [Popu... 58 3e-06 ref|XP_007048639.1| Tetratricopeptide repeat-like superfamily pr... 57 4e-06 ref|XP_010653047.1| PREDICTED: putative pentatricopeptide repeat... 57 5e-06 ref|XP_009392570.1| PREDICTED: putative pentatricopeptide repeat... 57 5e-06 >ref|XP_011622855.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Amborella trichopoda] Length = 803 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIE+ERR H+FV D+SHPQR VIYS+L+ L+QQ+KEP+ Sbjct: 759 WIELERRTHIFVVGDTSHPQRLVIYSILEGLDQQMKEPI 797 >ref|XP_008795326.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Phoenix dactylifera] Length = 851 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPLGRGK 392 WIEVER HVFVA D SHP R +I S L+TL++QIK+PLG+ K Sbjct: 809 WIEVERMRHVFVAGDLSHPLRPIIRSTLRTLDRQIKDPLGQSK 851 >ref|XP_004503024.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Cicer arietinum] Length = 874 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVER+ ++FVA D SHPQR++IYS L TL+QQ+KEP+ Sbjct: 834 WIEVERKNNIFVAGDCSHPQRSLIYSTLYTLDQQVKEPM 872 >ref|XP_011622390.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Amborella trichopoda] Length = 473 Score = 60.5 bits (145), Expect = 4e-07 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIE++RR H+FV D+SHPQR V+YS+L+ L+QQ+KEP+ Sbjct: 429 WIELQRRTHIFVVGDTSHPQRLVVYSILEGLDQQMKEPI 467 >ref|XP_007137835.1| hypothetical protein PHAVU_009G159700g [Phaseolus vulgaris] gi|561010922|gb|ESW09829.1| hypothetical protein PHAVU_009G159700g [Phaseolus vulgaris] Length = 875 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVER ++FVA D SHPQR++IYS L TL+QQ+KEP+ Sbjct: 833 WIEVERSNNIFVAGDCSHPQRSIIYSTLHTLDQQVKEPV 871 >ref|XP_009353795.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X2 [Pyrus x bretschneideri] Length = 768 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVERR ++F+A D SHP+R+VIYS L L+QQIKEP+ Sbjct: 730 WIEVERRKNIFIAGDWSHPERSVIYSTLSALDQQIKEPV 768 >ref|XP_009353788.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X1 [Pyrus x bretschneideri] Length = 890 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVERR ++F+A D SHP+R+VIYS L L+QQIKEP+ Sbjct: 852 WIEVERRKNIFIAGDWSHPERSVIYSTLSALDQQIKEPV 890 >gb|KHN09686.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 875 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVER ++FVA D SHPQR++IYS L+TL++Q+KEP+ Sbjct: 833 WIEVERTNNIFVAGDCSHPQRSIIYSTLQTLDRQVKEPV 871 >ref|XP_003528082.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490-like [Glycine max] Length = 875 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVER ++FVA D SHPQR++IYS L+TL++Q+KEP+ Sbjct: 833 WIEVERTNNIFVAGDCSHPQRSIIYSTLQTLDRQVKEPV 871 >gb|KHN31231.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 314 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEP 407 WIEVER ++FV D SHPQR++IYS L+TL+QQ+KEP Sbjct: 274 WIEVERTNNIFVVGDCSHPQRSIIYSTLQTLDQQVKEP 311 >ref|XP_008344493.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X3 [Malus domestica] Length = 633 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVERR ++F+A D SHP+R+VIYS L L+QQIKEP+ Sbjct: 595 WIEVERRKNLFIAGDWSHPERSVIYSTLSALDQQIKEPV 633 >ref|XP_008344488.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X2 [Malus domestica] Length = 766 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVERR ++F+A D SHP+R+VIYS L L+QQIKEP+ Sbjct: 728 WIEVERRKNLFIAGDWSHPERSVIYSTLSALDQQIKEPV 766 >ref|XP_008344479.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X1 [Malus domestica] Length = 888 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVERR ++F+A D SHP+R+VIYS L L+QQIKEP+ Sbjct: 850 WIEVERRKNLFIAGDWSHPERSVIYSTLSALDQQIKEPV 888 >ref|XP_006579323.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490-like [Glycine max] Length = 797 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEP 407 WIEVER ++FV D SHPQR++IYS L+TL+QQ+KEP Sbjct: 757 WIEVERTNNIFVVGDCSHPQRSIIYSTLQTLDQQVKEP 794 >ref|XP_010912874.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Elaeis guineensis] Length = 854 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPLGRGK 392 WIEVER H FVA D SHP R +IYS L+TL++QIK+PL K Sbjct: 812 WIEVERMRHAFVAGDLSHPLRPIIYSTLRTLDRQIKDPLSPRK 854 >ref|XP_009358063.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Pyrus x bretschneideri] Length = 888 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPL 404 WIEVER+ ++F+A D SHP+R+VIYS L L+QQIKEP+ Sbjct: 850 WIEVERKKNIFIAGDWSHPERSVIYSTLSALDQQIKEPV 888 >ref|XP_002306009.1| hypothetical protein POPTR_0004s14190g [Populus trichocarpa] gi|222848973|gb|EEE86520.1| hypothetical protein POPTR_0004s14190g [Populus trichocarpa] Length = 870 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEP 407 WIEVERR +VFVA D+SHP R IY +L TLN QIKEP Sbjct: 819 WIEVERRKNVFVAGDTSHPHRIDIYRILSTLNGQIKEP 856 >ref|XP_007048639.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508700900|gb|EOX92796.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 946 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/60 (48%), Positives = 37/60 (61%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPLGRGKPQW*IQEVTTELVYQQH 341 WIEV++R +VF+A D HP+R +IYS L TL+QQIKEP K EV + V H Sbjct: 841 WIEVKKRNNVFIAGDCLHPERKIIYSTLSTLDQQIKEPFLFDKINMTDHEVELDRVVADH 900 >ref|XP_010653047.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 isoform X1 [Vitis vinifera] Length = 853 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEP 407 WIEV RR +VF+A DSSHPQR++IY L TL+Q +KEP Sbjct: 813 WIEVGRRKNVFIAGDSSHPQRSIIYRTLSTLDQLMKEP 850 >ref|XP_009392570.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g08490 [Musa acuminata subsp. malaccensis] Length = 940 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 520 WIEVERRMHVFVAADSSHPQRAVIYSMLKTLNQQIKEPLGR 398 W+EV + HVFVA D SHPQR IYS L+TL+Q +KEP+ R Sbjct: 894 WLEVSMKRHVFVAGDLSHPQRTFIYSTLRTLDQLMKEPMER 934