BLASTX nr result
ID: Cinnamomum23_contig00006706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00006706 (289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012455279.1| PREDICTED: probable calcium-binding protein ... 59 1e-06 ref|XP_012455278.1| PREDICTED: probable calcium-binding protein ... 59 1e-06 gb|KJB72093.1| hypothetical protein B456_011G158400 [Gossypium r... 59 1e-06 gb|KHG12326.1| putative calcium-binding CML22 -like protein [Gos... 59 1e-06 ref|XP_007034372.1| Calcium-binding EF-hand family protein isofo... 59 1e-06 >ref|XP_012455279.1| PREDICTED: probable calcium-binding protein CML22 isoform X2 [Gossypium raimondii] Length = 225 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 287 EMDWHKNGRVSFKEFLFTFINWVGIEDDDE 198 EMDW KNG+VSF+EFLF FINWVGIE D+E Sbjct: 190 EMDWDKNGKVSFREFLFAFINWVGIESDEE 219 >ref|XP_012455278.1| PREDICTED: probable calcium-binding protein CML22 isoform X1 [Gossypium raimondii] gi|763805156|gb|KJB72094.1| hypothetical protein B456_011G158400 [Gossypium raimondii] Length = 244 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 287 EMDWHKNGRVSFKEFLFTFINWVGIEDDDE 198 EMDW KNG+VSF+EFLF FINWVGIE D+E Sbjct: 209 EMDWDKNGKVSFREFLFAFINWVGIESDEE 238 >gb|KJB72093.1| hypothetical protein B456_011G158400 [Gossypium raimondii] Length = 238 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 287 EMDWHKNGRVSFKEFLFTFINWVGIEDDDE 198 EMDW KNG+VSF+EFLF FINWVGIE D+E Sbjct: 203 EMDWDKNGKVSFREFLFAFINWVGIESDEE 232 >gb|KHG12326.1| putative calcium-binding CML22 -like protein [Gossypium arboreum] Length = 244 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 287 EMDWHKNGRVSFKEFLFTFINWVGIEDDDE 198 EMDW KNG+VSF+EFLF FINWVGIE D+E Sbjct: 209 EMDWDKNGKVSFREFLFAFINWVGIESDEE 238 >ref|XP_007034372.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] gi|508713401|gb|EOY05298.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] Length = 244 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 287 EMDWHKNGRVSFKEFLFTFINWVGIEDDDE 198 EMDW KNG+VSF+EFLF FINWVGIE D+E Sbjct: 212 EMDWDKNGKVSFREFLFAFINWVGIESDEE 241