BLASTX nr result
ID: Cinnamomum23_contig00006096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00006096 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010683293.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_010096318.1| hypothetical protein L484_021064 [Morus nota... 56 8e-06 >ref|XP_010683293.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870855428|gb|KMT07161.1| hypothetical protein BVRB_6g154870 [Beta vulgaris subsp. vulgaris] Length = 612 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/50 (52%), Positives = 35/50 (70%) Frame = -2 Query: 150 LKQVKGKPQLKQIHAQLLKTSPSIHPYHTVFLYSRIFHFYASSDLSYAAR 1 L +LKQIHAQ+L+T+PS HP H FLYSR+ HF +SSD+ Y+ + Sbjct: 36 LNHCSSMTELKQIHAQILRTTPSHHPKHLHFLYSRLLHFTSSSDIHYSLK 85 >ref|XP_010096318.1| hypothetical protein L484_021064 [Morus notabilis] gi|587874658|gb|EXB63793.1| hypothetical protein L484_021064 [Morus notabilis] Length = 611 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -2 Query: 153 FLKQVKGKPQLKQIHAQLLKTSPSIHPYHTVFLYSRIFHFYASSDLSYAAR 1 FL + K QLKQIHAQ L+T+ + + HT+FLYSRI HF + +D YA R Sbjct: 34 FLNECKDMSQLKQIHAQTLRTTSNTNNPHTLFLYSRILHFSSLADADYAFR 84