BLASTX nr result
ID: Cinnamomum23_contig00005967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00005967 (846 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 84 9e-14 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 81 7e-13 emb|CBI21459.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_007159454.1| hypothetical protein PHAVU_002G239000g, part... 62 5e-07 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 84.3 bits (207), Expect = 9e-14 Identities = 42/53 (79%), Positives = 45/53 (84%), Gaps = 2/53 (3%) Frame = +3 Query: 39 TKM--YRAIRTRTVDLLGKTDQTYYYRNDSNCFKDPTCVFFLHWALSLTDKKI 191 TKM RAIRTRTVDLLGKT++TYYYRND NCFKDPTC+ LHWALS TD KI Sbjct: 51 TKMECIRAIRTRTVDLLGKTEKTYYYRNDLNCFKDPTCI-LLHWALSSTDVKI 102 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 81.3 bits (199), Expect = 7e-13 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = +3 Query: 33 MNTKMYRAIRTRTVDLLGKTDQTYYYRNDSNCFKDPTCVFFLHWALSLTDKKI 191 M K Y R RTVDLLGKTDQT YYRNDSNCFKDPTC+ FLHWALS T+ KI Sbjct: 1 MEKKTYILGRIRTVDLLGKTDQTDYYRNDSNCFKDPTCI-FLHWALSSTNVKI 52 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 71.2 bits (173), Expect(2) = 2e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 51 RAIRTRTVDLLGKTDQTYYYRNDSNCFKDPTCVFF 155 RAIRTRTVDLLGKTDQT YY+ND NCFKDPTC+FF Sbjct: 38 RAIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIFF 72 Score = 22.3 bits (46), Expect(2) = 2e-10 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 152 FFALGSFIN 178 FFALGSFIN Sbjct: 71 FFALGSFIN 79 >ref|XP_007159454.1| hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] gi|561032869|gb|ESW31448.1| hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] Length = 53 Score = 62.0 bits (149), Expect = 5e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 51 RAIRTRTVDLLGKTDQTYYYRNDSNCFKDPTCVFFL 158 RAIRTRTVDLLGKT +T+YY ND NCF +PTC+F L Sbjct: 12 RAIRTRTVDLLGKTAKTHYYLNDFNCFLNPTCIFLL 47