BLASTX nr result
ID: Cinnamomum23_contig00005472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00005472 (208 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptu... 57 4e-06 gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus g... 57 4e-06 ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1... 57 5e-06 >ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis] Length = 367 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/68 (48%), Positives = 41/68 (60%) Frame = -2 Query: 207 YRRRRSKEGDGATAKVFLIKPGLFASCVVLGLLTGLDDYMYAYGXXXXXXXXXXXXXXXX 28 Y RRRS EG +A++ L+ P LFA+ V+G+LTGLDDY+YAYG Sbjct: 87 YLRRRSAEGP--SARLVLMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQ 144 Query: 27 LAFQAGFA 4 LAF AGFA Sbjct: 145 LAFTAGFA 152 >gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus grandis] Length = 261 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/68 (48%), Positives = 41/68 (60%) Frame = -2 Query: 207 YRRRRSKEGDGATAKVFLIKPGLFASCVVLGLLTGLDDYMYAYGXXXXXXXXXXXXXXXX 28 Y RRRS EG +A++ L+ P LFA+ V+G+LTGLDDY+YAYG Sbjct: 87 YLRRRSAEGP--SARLVLMDPFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALLIATQ 144 Query: 27 LAFQAGFA 4 LAF AGFA Sbjct: 145 LAFTAGFA 152 >ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis] gi|702361978|ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis] gi|702361983|ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis] gi|629101126|gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis] Length = 360 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/68 (47%), Positives = 41/68 (60%) Frame = -2 Query: 207 YRRRRSKEGDGATAKVFLIKPGLFASCVVLGLLTGLDDYMYAYGXXXXXXXXXXXXXXXX 28 Y RRR+ EG +A++ L+ P LFA+ V+G+LTGLDDY+YAYG Sbjct: 69 YFRRRAAEGP--SARLILMDPFLFAAAAVIGVLTGLDDYLYAYGVARLPVSTSALLIATQ 126 Query: 27 LAFQAGFA 4 LAF AGFA Sbjct: 127 LAFTAGFA 134