BLASTX nr result
ID: Cinnamomum23_contig00005025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00005025 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002894421.1| cytochrome c oxidase copper chaperone family... 69 9e-10 ref|XP_006392840.1| hypothetical protein EUTSA_v10011917mg [Eutr... 68 2e-09 ref|XP_010500930.1| PREDICTED: cytochrome c oxidase copper chape... 68 3e-09 ref|NP_175711.1| Cytochrome C oxidase copper chaperone (COX17) [... 68 3e-09 ref|XP_010462158.1| PREDICTED: cytochrome c oxidase copper chape... 67 5e-09 gb|ABK23831.1| unknown [Picea sitchensis] 67 5e-09 ref|XP_006878611.2| PREDICTED: cytochrome c oxidase copper chape... 67 6e-09 ref|XP_009381571.1| PREDICTED: cytochrome c oxidase copper chape... 67 6e-09 ref|XP_009147639.1| PREDICTED: cytochrome c oxidase copper chape... 67 6e-09 gb|ERM94756.1| hypothetical protein AMTR_s00011p00257480 [Ambore... 67 6e-09 ref|XP_010479835.1| PREDICTED: cytochrome c oxidase copper chape... 66 8e-09 ref|XP_010235917.1| PREDICTED: cytochrome c oxidase copper chape... 66 8e-09 ref|XP_006304838.1| hypothetical protein CARUB_v10012519mg [Caps... 66 8e-09 ref|XP_011628099.1| PREDICTED: cytochrome c oxidase copper chape... 66 1e-08 ref|XP_010694991.1| PREDICTED: cytochrome c oxidase copper chape... 65 1e-08 gb|ABD38858.1| At1g53030 [Arabidopsis thaliana] 65 1e-08 gb|EMS68516.1| Cytochrome c oxidase copper chaperone [Triticum u... 65 1e-08 gb|AAM61247.1| cytochrome C oxidase assembly protein, putative [... 65 1e-08 emb|CDY26017.1| BnaC06g06070D [Brassica napus] 64 3e-08 gb|ERN18777.1| hypothetical protein AMTR_s00067p00068140 [Ambore... 64 3e-08 >ref|XP_002894421.1| cytochrome c oxidase copper chaperone family protein [Arabidopsis lyrata subsp. lyrata] gi|297340263|gb|EFH70680.1| cytochrome c oxidase copper chaperone family protein [Arabidopsis lyrata subsp. lyrata] Length = 72 Score = 69.3 bits (168), Expect = 9e-10 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAHL CLRSEGFKV Sbjct: 41 LRDECIVEHGESACTKWIEAHLSCLRSEGFKV 72 >ref|XP_006392840.1| hypothetical protein EUTSA_v10011917mg [Eutrema salsugineum] gi|567131943|ref|XP_006392841.1| hypothetical protein EUTSA_v10011917mg [Eutrema salsugineum] gi|557089418|gb|ESQ30126.1| hypothetical protein EUTSA_v10011917mg [Eutrema salsugineum] gi|557089419|gb|ESQ30127.1| hypothetical protein EUTSA_v10011917mg [Eutrema salsugineum] Length = 72 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAHL CLRSEGFKV Sbjct: 41 LRDECIVEHGESACTKWIEAHLICLRSEGFKV 72 >ref|XP_010500930.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Camelina sativa] Length = 73 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH+ CLRSEGFKV Sbjct: 42 LRDECIVEHGESACTKWIEAHILCLRSEGFKV 73 >ref|NP_175711.1| Cytochrome C oxidase copper chaperone (COX17) [Arabidopsis thaliana] gi|75165626|sp|Q94FT1.1|CX172_ARATH RecName: Full=Cytochrome c oxidase copper chaperone 2 gi|14794886|gb|AAK73497.1|AF349685_1 copper chaperone COX17-2 [Arabidopsis thaliana] gi|332194758|gb|AEE32879.1| Cytochrome C oxidase copper chaperone (COX17) [Arabidopsis thaliana] Length = 72 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH+ CLRSEGFKV Sbjct: 41 LRDECIVEHGESACTKWIEAHILCLRSEGFKV 72 >ref|XP_010462158.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Camelina sativa] Length = 72 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIV+HGE ACTKWIEAHL CLRSEGFKV Sbjct: 41 LRDECIVKHGESACTKWIEAHLLCLRSEGFKV 72 >gb|ABK23831.1| unknown [Picea sitchensis] Length = 71 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWI+AHL+CLR+EGFKV Sbjct: 40 LRDECIVEHGEDACTKWIDAHLRCLRAEGFKV 71 >ref|XP_006878611.2| PREDICTED: cytochrome c oxidase copper chaperone [Amborella trichopoda] Length = 119 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE AC+KWIEAHLQCLR+EGF V Sbjct: 88 LRDECIVEHGEAACSKWIEAHLQCLRAEGFNV 119 >ref|XP_009381571.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Musa acuminata subsp. malaccensis] Length = 89 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE AC KWI+AHLQCLR+EGFKV Sbjct: 58 LRDECIVEHGEAACKKWIQAHLQCLRAEGFKV 89 >ref|XP_009147639.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Brassica rapa] gi|674909058|emb|CDY24124.1| BnaA06g01220D [Brassica napus] Length = 72 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVE+GE ACTKWIEAHL CLRSEGFKV Sbjct: 41 LRDECIVENGESACTKWIEAHLMCLRSEGFKV 72 >gb|ERM94756.1| hypothetical protein AMTR_s00011p00257480 [Amborella trichopoda] Length = 152 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE AC+KWIEAHLQCLR+EGF V Sbjct: 61 LRDECIVEHGEAACSKWIEAHLQCLRAEGFNV 92 >ref|XP_010479835.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Camelina sativa] Length = 72 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH CLRSEGFKV Sbjct: 41 LRDECIVEHGESACTKWIEAHRLCLRSEGFKV 72 >ref|XP_010235917.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Brachypodium distachyon] Length = 75 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH +CLR+EGFKV Sbjct: 44 LRDECIVEHGESACTKWIEAHKRCLRAEGFKV 75 >ref|XP_006304838.1| hypothetical protein CARUB_v10012519mg [Capsella rubella] gi|482573549|gb|EOA37736.1| hypothetical protein CARUB_v10012519mg [Capsella rubella] Length = 72 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH CLRSEGFKV Sbjct: 41 LRDECIVEHGESACTKWIEAHRLCLRSEGFKV 72 >ref|XP_011628099.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Amborella trichopoda] Length = 92 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE AC+KWIEAHLQCLR EGF V Sbjct: 61 LRDECIVEHGEAACSKWIEAHLQCLRMEGFNV 92 >ref|XP_010694991.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Beta vulgaris subsp. vulgaris] gi|870845221|gb|KMS97997.1| hypothetical protein BVRB_4g096790 [Beta vulgaris subsp. vulgaris] Length = 74 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH QCLR+EGF V Sbjct: 43 LRDECIVEHGEDACTKWIEAHKQCLRAEGFNV 74 >gb|ABD38858.1| At1g53030 [Arabidopsis thaliana] Length = 72 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH+ CLRSE FKV Sbjct: 41 LRDECIVEHGESACTKWIEAHILCLRSESFKV 72 >gb|EMS68516.1| Cytochrome c oxidase copper chaperone [Triticum urartu] Length = 88 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVE+GE ACTKWIEAH QCLR+EGFKV Sbjct: 57 LRDECIVEYGESACTKWIEAHKQCLRAEGFKV 88 >gb|AAM61247.1| cytochrome C oxidase assembly protein, putative [Arabidopsis thaliana] Length = 72 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVEHGE ACTKWIEAH+ CLRSE FKV Sbjct: 41 LRDECIVEHGESACTKWIEAHILCLRSESFKV 72 >emb|CDY26017.1| BnaC06g06070D [Brassica napus] Length = 72 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGFKV 222 LRDECIVE+GE ACTKWIEAH CLRSEGFKV Sbjct: 41 LRDECIVENGESACTKWIEAHRMCLRSEGFKV 72 >gb|ERN18777.1| hypothetical protein AMTR_s00067p00068140 [Amborella trichopoda] Length = 93 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 317 LRDECIVEHGEGACTKWIEAHLQCLRSEGF 228 LRDECIVEHGE AC+KWIEAHLQCLR EGF Sbjct: 61 LRDECIVEHGEAACSKWIEAHLQCLRMEGF 90