BLASTX nr result
ID: Cinnamomum23_contig00004972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00004972 (200 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029665.1| Leucine-rich repeat containing protein, puta... 72 1e-10 ref|XP_007029657.1| LRR and NB-ARC domains-containing disease re... 70 7e-10 ref|XP_006490005.1| PREDICTED: putative disease resistance prote... 69 9e-10 ref|XP_007029649.1| LRR and NB-ARC domains-containing disease re... 68 2e-09 gb|KJB18495.1| hypothetical protein B456_003G056000 [Gossypium r... 68 3e-09 ref|XP_006421376.1| hypothetical protein CICLE_v100065072mg, par... 67 6e-09 ref|XP_007029654.1| LRR and NB-ARC domains-containing disease re... 66 8e-09 ref|XP_007029648.1| Leucine-rich repeat containing protein, puta... 66 1e-08 ref|XP_007029652.1| LRR and NB-ARC domains-containing disease re... 65 1e-08 ref|XP_007029660.1| LRR and NB-ARC domains-containing disease re... 65 2e-08 gb|KDO36172.1| hypothetical protein CISIN_1g037039mg, partial [C... 64 3e-08 ref|XP_006489979.1| PREDICTED: putative disease resistance prote... 64 3e-08 ref|XP_006421378.1| hypothetical protein CICLE_v10006443mg [Citr... 64 3e-08 ref|XP_007029662.1| LRR and NB-ARC domains-containing disease re... 64 4e-08 ref|XP_006439154.1| hypothetical protein CICLE_v10010866mg, part... 64 5e-08 ref|XP_006421379.1| hypothetical protein CICLE_v10006930mg [Citr... 64 5e-08 ref|XP_007029651.1| Leucine-rich repeat containing protein, puta... 63 7e-08 gb|KDO42049.1| hypothetical protein CISIN_1g041348mg [Citrus sin... 62 1e-07 gb|KDO39460.1| hypothetical protein CISIN_1g038265mg [Citrus sin... 62 1e-07 ref|XP_006421380.1| hypothetical protein CICLE_v10006925mg [Citr... 62 1e-07 >ref|XP_007029665.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639427|ref|XP_007029666.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639430|ref|XP_007029667.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639433|ref|XP_007029668.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639436|ref|XP_007029669.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639439|ref|XP_007029670.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718270|gb|EOY10167.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718271|gb|EOY10168.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718272|gb|EOY10169.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718273|gb|EOY10170.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718274|gb|EOY10171.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718275|gb|EOY10172.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] Length = 881 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/65 (52%), Positives = 41/65 (63%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 W++KLKDA YDAED+ Q +G KVCNFFS SNPL FR KMAH +K+ Sbjct: 65 WVQKLKDACYDAEDVLDEFEVESLRGQVLEQKCIGNKVCNFFSSSNPLVFRLKMAHKIKK 124 Query: 20 LVERF 6 + ERF Sbjct: 125 ITERF 129 >ref|XP_007029657.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508718262|gb|EOY10159.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 773 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/65 (52%), Positives = 42/65 (64%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL+KLKDA YDAED+ Q +GKKV NFFS SNP+AFR +MAH +K+ Sbjct: 65 WLQKLKDACYDAEDVLDEFQIEAWRRQVLKQRNIGKKVRNFFSSSNPVAFRFRMAHKIKK 124 Query: 20 LVERF 6 + ERF Sbjct: 125 VTERF 129 >ref|XP_006490005.1| PREDICTED: putative disease resistance protein RGA1-like [Citrus sinensis] gi|641813103|gb|KDO37514.1| hypothetical protein CISIN_1g036168mg [Citrus sinensis] Length = 846 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAEDL Q +G+ + NFF SNP+AFRC+M H +K+ Sbjct: 63 WLEKLKDACYDAEDLLDDFEVEALRRQVMKQRSIGRNLRNFFGSSNPIAFRCRMGHQIKK 122 Query: 20 LVERFD 3 + ERFD Sbjct: 123 IRERFD 128 >ref|XP_007029649.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508718254|gb|EOY10151.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 522 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/65 (50%), Positives = 41/65 (63%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL++LKDA YDAED+ Q +G KV NFFS SNPLAFR +MAH +K+ Sbjct: 65 WLQELKDACYDAEDVLDEFEVEALWRQALKQRSLGDKVSNFFSSSNPLAFRFRMAHKIKK 124 Query: 20 LVERF 6 + ERF Sbjct: 125 VTERF 129 >gb|KJB18495.1| hypothetical protein B456_003G056000 [Gossypium raimondii] Length = 796 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/65 (52%), Positives = 41/65 (63%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL++LKDA YDAED+ Q +GKKV FFS S PLAFRCKMAH +K+ Sbjct: 64 WLQELKDACYDAEDVLDEFEIQALKKQLLKQRTIGKKVSYFFSISKPLAFRCKMAHKIKQ 123 Query: 20 LVERF 6 L +RF Sbjct: 124 LNQRF 128 >ref|XP_006421376.1| hypothetical protein CICLE_v100065072mg, partial [Citrus clementina] gi|557523249|gb|ESR34616.1| hypothetical protein CICLE_v100065072mg, partial [Citrus clementina] Length = 159 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/66 (46%), Positives = 40/66 (60%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAEDL Q +G+ + NFF SNP+AFRC+M H +K+ Sbjct: 63 WLEKLKDAYYDAEDLLDDFEVQALRRQVMKQRSIGRNLRNFFGSSNPIAFRCRMGHQIKK 122 Query: 20 LVERFD 3 + ERF+ Sbjct: 123 IRERFN 128 >ref|XP_007029654.1| LRR and NB-ARC domains-containing disease resistance protein [Theobroma cacao] gi|508718259|gb|EOY10156.1| LRR and NB-ARC domains-containing disease resistance protein [Theobroma cacao] Length = 559 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/65 (50%), Positives = 41/65 (63%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL+KLKDA YDAED+ Q + KKV NFFS SNP+AFR +MAH +K+ Sbjct: 146 WLQKLKDACYDAEDVLDEFEIEAWRRQVLKQRNIVKKVRNFFSSSNPVAFRFRMAHKIKK 205 Query: 20 LVERF 6 + ERF Sbjct: 206 VTERF 210 >ref|XP_007029648.1| Leucine-rich repeat containing protein, putative [Theobroma cacao] gi|508718253|gb|EOY10150.1| Leucine-rich repeat containing protein, putative [Theobroma cacao] Length = 870 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL++L+DA YDA+D+ Q +GKKV +FFS SNPLAFR K+AH +K+ Sbjct: 65 WLQELRDACYDADDVLDEFEIEALRKQVVKQRSIGKKVSHFFSSSNPLAFRFKLAHKIKK 124 Query: 20 LVERF 6 + ERF Sbjct: 125 VTERF 129 >ref|XP_007029652.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508718257|gb|EOY10154.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 870 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL++L+DA YDAED+ Q +GK+V +FFS SNPLAFR +MAH +K+ Sbjct: 65 WLQELRDACYDAEDVLDEFEIEALRKQVVKQRSIGKQVSHFFSSSNPLAFRFRMAHKVKK 124 Query: 20 LVERF 6 + ERF Sbjct: 125 VTERF 129 >ref|XP_007029660.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] gi|508718265|gb|EOY10162.1| LRR and NB-ARC domains-containing disease resistance protein, putative [Theobroma cacao] Length = 859 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/65 (49%), Positives = 41/65 (63%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL+KLKDA Y AED+ Q +GKKV +FFS SNP+AFR +MAH +K+ Sbjct: 90 WLQKLKDACYGAEDVLDEFQIEALRKQVLKQRSIGKKVHSFFSSSNPVAFRFRMAHKIKK 149 Query: 20 LVERF 6 + ERF Sbjct: 150 VTERF 154 >gb|KDO36172.1| hypothetical protein CISIN_1g037039mg, partial [Citrus sinensis] Length = 505 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K NFF SNP+AFR +M H +K+ Sbjct: 63 WLGKLKDACYDAEDVLDEFEVEDQRRQVMKQRSIGRKFRNFFGSSNPIAFRFRMGHQIKK 122 Query: 20 LVERFD 3 + ERFD Sbjct: 123 IRERFD 128 >ref|XP_006489979.1| PREDICTED: putative disease resistance protein RGA1-like isoform X1 [Citrus sinensis] gi|568873727|ref|XP_006489980.1| PREDICTED: putative disease resistance protein RGA1-like isoform X2 [Citrus sinensis] Length = 755 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K NFF SNP+AFR +M H +K+ Sbjct: 63 WLGKLKDACYDAEDVLDEFEVEDQRRQVMKQRSIGRKFRNFFGSSNPIAFRFRMGHQIKK 122 Query: 20 LVERFD 3 + ERFD Sbjct: 123 IRERFD 128 >ref|XP_006421378.1| hypothetical protein CICLE_v10006443mg [Citrus clementina] gi|557523251|gb|ESR34618.1| hypothetical protein CICLE_v10006443mg [Citrus clementina] Length = 607 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K NFF SNP+AFR +M H +K+ Sbjct: 41 WLGKLKDACYDAEDVLDEFEVENLRRQVMKQRSIGRKFRNFFGSSNPIAFRFRMGHQIKK 100 Query: 20 LVERFD 3 + ERFD Sbjct: 101 IRERFD 106 >ref|XP_007029662.1| LRR and NB-ARC domains-containing disease resistance protein [Theobroma cacao] gi|508718267|gb|EOY10164.1| LRR and NB-ARC domains-containing disease resistance protein [Theobroma cacao] Length = 1238 Score = 63.9 bits (154), Expect = 4e-08 Identities = 32/65 (49%), Positives = 40/65 (61%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +GKKV +FFS SNP+AFR +MAH +K+ Sbjct: 758 WLLKLKDACYDAEDVLDEFQIEAWRRQVLKQRNIGKKVRSFFSSSNPVAFRFRMAHKIKK 817 Query: 20 LVERF 6 + RF Sbjct: 818 VTGRF 822 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/65 (46%), Positives = 38/65 (58%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL+KLKDA YDAED+ Q + KKV +F S SNP+ FR +MAH +K+ Sbjct: 65 WLQKLKDACYDAEDVLDEFQIEALRRQVLEQRNIEKKVRSFLSSSNPITFRFRMAHKIKK 124 Query: 20 LVERF 6 ERF Sbjct: 125 ATERF 129 >ref|XP_006439154.1| hypothetical protein CICLE_v10010866mg, partial [Citrus clementina] gi|557541401|gb|ESR52394.1| hypothetical protein CICLE_v10010866mg, partial [Citrus clementina] Length = 647 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K NFF SNP+AFR +M H +K+ Sbjct: 26 WLGKLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGRKFRNFFGCSNPIAFRFRMGHQIKK 85 Query: 20 LVERFD 3 + ERFD Sbjct: 86 IRERFD 91 >ref|XP_006421379.1| hypothetical protein CICLE_v10006930mg [Citrus clementina] gi|557523252|gb|ESR34619.1| hypothetical protein CICLE_v10006930mg [Citrus clementina] Length = 832 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K NFF SNP+AFR +M H +K+ Sbjct: 63 WLGKLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGRKFRNFFGCSNPIAFRFRMGHQIKK 122 Query: 20 LVERFD 3 + ERFD Sbjct: 123 IRERFD 128 >ref|XP_007029651.1| Leucine-rich repeat containing protein, putative [Theobroma cacao] gi|508718256|gb|EOY10153.1| Leucine-rich repeat containing protein, putative [Theobroma cacao] Length = 870 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL++L+DA YDA+D+ Q +GKKV +FFS SNPLAFR KM H +K+ Sbjct: 65 WLQELRDACYDADDVLDEFEIEALRKQVVKQRSVGKKVSHFFSSSNPLAFRFKMGHKIKK 124 Query: 20 LVERF 6 + E F Sbjct: 125 VTESF 129 >gb|KDO42049.1| hypothetical protein CISIN_1g041348mg [Citrus sinensis] Length = 867 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/66 (45%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K+ NFF SNP+AFR +M +K+ Sbjct: 63 WLEKLKDACYDAEDVLDEFEVEDLRRQVMKQRSIGRKLRNFFGSSNPIAFRFRMCQQIKK 122 Query: 20 LVERFD 3 + ERFD Sbjct: 123 VRERFD 128 >gb|KDO39460.1| hypothetical protein CISIN_1g038265mg [Citrus sinensis] Length = 883 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/66 (45%), Positives = 38/66 (57%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED Q +G+K+ NFF SNP+AF +M H +K+ Sbjct: 63 WLEKLKDACYDAEDALDEFEVEDLRRQVIKQRSIGRKLRNFFGSSNPIAFCFRMGHQLKK 122 Query: 20 LVERFD 3 + ERFD Sbjct: 123 IRERFD 128 >ref|XP_006421380.1| hypothetical protein CICLE_v10006925mg [Citrus clementina] gi|557523253|gb|ESR34620.1| hypothetical protein CICLE_v10006925mg [Citrus clementina] Length = 851 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/66 (45%), Positives = 39/66 (59%) Frame = -1 Query: 200 WLRKLKDAAYDAEDLXXXXXXXXXXXXXENQDGMGKKVCNFFSPSNPLAFRCKMAHGMKE 21 WL KLKDA YDAED+ Q +G+K+ NFF SNP+AFR +M +K+ Sbjct: 47 WLEKLKDACYDAEDVLDEFEVEDLRRQVMTQRSIGRKLRNFFGSSNPIAFRFRMCQQIKK 106 Query: 20 LVERFD 3 + ERFD Sbjct: 107 VRERFD 112