BLASTX nr result
ID: Cinnamomum23_contig00004268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum23_contig00004268 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514749.1| geranylgeranyl hydrogenase, putative [Ricinu... 99 8e-19 ref|XP_011071704.1| PREDICTED: geranylgeranyl diphosphate reduct... 99 8e-19 ref|XP_010939800.1| PREDICTED: geranylgeranyl diphosphate reduct... 99 1e-18 gb|ACQ41835.1| geranyl-geranyl reductase [Elaeis oleifera] 99 1e-18 dbj|BAH10639.1| geranylgeranyl reductase [Hevea brasiliensis] 98 2e-18 ref|XP_012839365.1| PREDICTED: geranylgeranyl diphosphate reduct... 98 2e-18 ref|XP_011007091.1| PREDICTED: geranylgeranyl diphosphate reduct... 97 4e-18 gb|KDO55558.1| hypothetical protein CISIN_1g012488mg [Citrus sin... 97 4e-18 emb|CBI15217.3| unnamed protein product [Vitis vinifera] 97 4e-18 ref|XP_006440606.1| hypothetical protein CICLE_v10020061mg [Citr... 97 4e-18 ref|XP_002317979.2| geranylgeranyl reductase family protein [Pop... 97 4e-18 gb|ABK95678.1| unknown [Populus trichocarpa] 97 4e-18 ref|XP_002284906.1| PREDICTED: geranylgeranyl diphosphate reduct... 97 4e-18 emb|CAN61003.1| hypothetical protein VITISV_009187 [Vitis vinifera] 97 4e-18 ref|XP_003524776.1| PREDICTED: geranylgeranyl diphosphate reduct... 97 5e-18 gb|AAD28640.2| geranylgeranyl hydrogenase [Glycine max] 97 5e-18 ref|XP_012080275.1| PREDICTED: geranylgeranyl diphosphate reduct... 96 7e-18 ref|XP_008453207.1| PREDICTED: geranylgeranyl diphosphate reduct... 96 7e-18 ref|XP_006477461.1| PREDICTED: geranylgeranyl diphosphate reduct... 96 9e-18 ref|XP_010539971.1| PREDICTED: geranylgeranyl diphosphate reduct... 96 1e-17 >ref|XP_002514749.1| geranylgeranyl hydrogenase, putative [Ricinus communis] gi|223546353|gb|EEF47855.1| geranylgeranyl hydrogenase, putative [Ricinus communis] Length = 465 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPL+DLKLA NTIGSLVRANALRKEMNK+SV Sbjct: 415 DEYVQKMTFDSYLYKRVVPGNPLDDLKLAFNTIGSLVRANALRKEMNKLSV 465 >ref|XP_011071704.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Sesamum indicum] gi|300825706|gb|ADK35887.1| geranylgeranyl reductase [Sesamum indicum] Length = 465 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALRKEM K+SV Sbjct: 415 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRKEMEKLSV 465 >ref|XP_010939800.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Elaeis guineensis] Length = 475 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EMNKI++ Sbjct: 425 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMNKITL 475 >gb|ACQ41835.1| geranyl-geranyl reductase [Elaeis oleifera] Length = 207 Score = 99.0 bits (245), Expect = 1e-18 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EMNKI++ Sbjct: 157 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMNKITL 207 >dbj|BAH10639.1| geranylgeranyl reductase [Hevea brasiliensis] Length = 471 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK+VVPGNPL+DLKLA NTIGSLVRANALRKEMNK+SV Sbjct: 421 DEYVQKMTFDSYLYKKVVPGNPLDDLKLAFNTIGSLVRANALRKEMNKLSV 471 >ref|XP_012839365.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Erythranthe guttatus] gi|604330926|gb|EYU35827.1| hypothetical protein MIMGU_mgv1a027074mg [Erythranthe guttata] Length = 466 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQ+MTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALRKEM K+SV Sbjct: 416 DEYVQRMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRKEMEKLSV 466 >ref|XP_011007091.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Populus euphratica] Length = 456 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKIS 167 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+S Sbjct: 406 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 455 >gb|KDO55558.1| hypothetical protein CISIN_1g012488mg [Citrus sinensis] Length = 462 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+++ Sbjct: 412 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 462 >emb|CBI15217.3| unnamed protein product [Vitis vinifera] Length = 351 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+SV Sbjct: 301 DEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 351 >ref|XP_006440606.1| hypothetical protein CICLE_v10020061mg [Citrus clementina] gi|557542868|gb|ESR53846.1| hypothetical protein CICLE_v10020061mg [Citrus clementina] Length = 462 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+++ Sbjct: 412 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 462 >ref|XP_002317979.2| geranylgeranyl reductase family protein [Populus trichocarpa] gi|550326551|gb|EEE96199.2| geranylgeranyl reductase family protein [Populus trichocarpa] Length = 470 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKIS 167 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+S Sbjct: 420 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 469 >gb|ABK95678.1| unknown [Populus trichocarpa] Length = 470 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKIS 167 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+S Sbjct: 420 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLS 469 >ref|XP_002284906.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Vitis vinifera] Length = 467 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+SV Sbjct: 417 DEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 467 >emb|CAN61003.1| hypothetical protein VITISV_009187 [Vitis vinifera] Length = 447 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+SV Sbjct: 397 DEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKMSV 447 >ref|XP_003524776.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Glycine max] Length = 462 Score = 96.7 bits (239), Expect = 5e-18 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK VVPGNPLEDLKLAINTIGSLVRANA+R+EMNK++V Sbjct: 412 DEYVQKMTFDSYLYKTVVPGNPLEDLKLAINTIGSLVRANAIRREMNKLNV 462 >gb|AAD28640.2| geranylgeranyl hydrogenase [Glycine max] Length = 462 Score = 96.7 bits (239), Expect = 5e-18 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK VVPGNPLEDLKLAINTIGSLVRANA+R+EMNK++V Sbjct: 412 DEYVQKMTFDSYLYKTVVPGNPLEDLKLAINTIGSLVRANAIRREMNKLNV 462 >ref|XP_012080275.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Jatropha curcas] gi|643720995|gb|KDP31259.1| hypothetical protein JCGZ_11635 [Jatropha curcas] Length = 471 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPL+D+KLA+NTIGSLVRANALR+EM+K+SV Sbjct: 421 DEYVQKMTFDSYLYKRVVPGNPLDDIKLALNTIGSLVRANALRREMDKLSV 471 >ref|XP_008453207.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Cucumis melo] gi|510379436|gb|AGN48012.1| geranylgeranyl hydrogenase [Cucumis melo] Length = 465 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANAL++EM K+S+ Sbjct: 415 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALKREMEKVSL 465 >ref|XP_006477461.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic-like [Citrus sinensis] Length = 465 Score = 95.9 bits (237), Expect = 9e-18 Identities = 44/51 (86%), Positives = 51/51 (100%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYK+VVPGNPLEDLKLA+NTIGSLVRANALR+EM+K+++ Sbjct: 415 DEYVQKMTFDSYLYKKVVPGNPLEDLKLAVNTIGSLVRANALRREMDKLTI 465 >ref|XP_010539971.1| PREDICTED: geranylgeranyl diphosphate reductase, chloroplastic [Tarenaya hassleriana] Length = 467 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/51 (88%), Positives = 50/51 (98%) Frame = -1 Query: 316 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAINTIGSLVRANALRKEMNKISV 164 DEYVQKMTFDSYLYKRVVPGNPLEDLKLA+NTIGSLVRANALR+E+ K++V Sbjct: 417 DEYVQKMTFDSYLYKRVVPGNPLEDLKLAVNTIGSLVRANALRREIEKLNV 467